DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and LOC1279017

DIOPT Version :10

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_318674.2 Gene:LOC1279017 / 1279017 VectorBaseID:AGAMI1_009520 Length:115 Species:Anopheles gambiae


Alignment Length:95 Identity:23/95 - (24%)
Similarity:43/95 - (45%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 FLISVLLEVYLLC----SFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKA 377
            :|:.:..:|::.|    ..|......:|.||.:.|    ...|||..:.:||....:.|.|.:|.
Mosquito    22 YLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNY----FKFDKRTSQAMIFFLQMTLKDVHIKV 82

  Fly   378 TVVL--DLSMPTMSIFLGMSYKFFCAVRTM 405
            ..||  .|::.|....:.:||.:...:::|
Mosquito    83 GSVLKVTLNLHTFLQIMKLSYSYLAVLQSM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 20/84 (24%)
LOC1279017XP_318674.2 None

Return to query results.
Submit another query.