DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and LOC1277252

DIOPT Version :10

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_061505089.1 Gene:LOC1277252 / 1277252 VectorBaseID:AGAMI1_007534 Length:130 Species:Anopheles gambiae


Alignment Length:34 Identity:8/34 - (23%)
Similarity:15/34 - (44%) Gaps:10/34 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LMIFAVVLQVIM----------HYERLAKVLREF 241
            ||:...||.:|:          .::.:|:...||
Mosquito    50 LMLLGTVLLLIVPKIVLGTGSDSFDSIARSTAEF 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 8/34 (24%)
LOC1277252XP_061505089.1 None

Return to query results.
Submit another query.