DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG14301

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_650734.2 Gene:CG14301 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster

Alignment Length:147 Identity:56/148 (38%)
Similarity:79/148 (53%) Gaps:33/148 (22%)


  Fly    34 PQP----EHPQHHEKKQDL-------------------NKIPGVPGVDYPIYHEVPHTHFSCHNV 75
            |:|    |:.::..:::||                   ..|||.|||||||...||:|:|.| :.
  Fly    43 PEPQQDLENDENGSQEKDLPEIPDNFLSPSVREYLELGKSIPGRPGVDYPILSAVPYTNFYC-DE 106

  Fly    76 PATPGMYANVETGCQAYHVCH-DGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHL 139
            ...||.:|::||.||.:|.|. |||:    |.|||.|||.|:|..|.||||:||:|:.:...|.:
  Fly   107 QEYPGFFADMETRCQGWHYCDIDGRQ----ATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAI 167

  Fly   140 NA----DPEHNPYIPKK 152
            ||    .|:.||..|.:
  Fly   168 NARLYQRPKVNPTRPHR 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 27/51 (53%)
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.