DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG14304

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:177 Identity:63/177 - (35%)
Similarity:73/177 - (41%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NPPQPEHPQHHEKKQDL------------------------NKIPGV----PGVDYPIYHEVPHT 68
            |||| .|.:|....||.                        ||.||.    ||:|||.|.|:|.|
  Fly   796 NPPQ-HHDEHKSSAQDYDYNTGSEEEHHSQSEEAIARPKGPNKHPGPSTGRPGIDYPNYAEIPQT 859

  Fly    69 HFSCHNVPATPGMYANVETGCQAYHVC--HDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCE 131
            .|.| ......|.:.:.||.||.:|.|  :.|:     |.|||.|||||:|....||||:||||.
  Fly   860 SFEC-TKQRYKGFFGDPETNCQVWHYCDLNGGK-----ASFLCPNGTIFSQIALTCDWWFNVKCS 918

  Fly   132 EATHFYHLNAD------PEHNPYIPKKKPELEPYANDIHD---ASKF 169
            .....|.||..      | .||..|      |.|...|.|   |.||
  Fly   919 TTAQLYVLNERLYKYILP-FNPKFP------EDYNGPIVDKYLAMKF 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 24/51 (47%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.