DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG14304

DIOPT Version :10

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_650731.3 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:177 Identity:63/177 - (35%)
Similarity:73/177 - (41%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NPPQPEHPQHHEKKQDL------------------------NKIPGV----PGVDYPIYHEVPHT 68
            |||| .|.:|....||.                        ||.||.    ||:|||.|.|:|.|
  Fly   796 NPPQ-HHDEHKSSAQDYDYNTGSEEEHHSQSEEAIARPKGPNKHPGPSTGRPGIDYPNYAEIPQT 859

  Fly    69 HFSCHNVPATPGMYANVETGCQAYHVC--HDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCE 131
            .|.| ......|.:.:.||.||.:|.|  :.|:     |.|||.|||||:|....||||:||||.
  Fly   860 SFEC-TKQRYKGFFGDPETNCQVWHYCDLNGGK-----ASFLCPNGTIFSQIALTCDWWFNVKCS 918

  Fly   132 EATHFYHLNAD------PEHNPYIPKKKPELEPYANDIHD---ASKF 169
            .....|.||..      | .||..|      |.|...|.|   |.||
  Fly   919 TTAQLYVLNERLYKYILP-FNPKFP------EDYNGPIVDKYLAMKF 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:426342 24/51 (47%)
CG14304NP_650731.3 PAT1 <524..>682 CDD:401645
PHA03247 <605..802 CDD:223021 4/6 (67%)
CBM_14 863..917 CDD:426342 25/59 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.