DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG14880

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_650538.1 Gene:CG14880 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster

Alignment Length:112 Identity:43/113 (38%)
Similarity:55/113 (49%) Gaps:22/113 (19%)


  Fly    65 VPHTHFSCHNVPATPGMYANVETGCQAYHVCHD-GREGDQGAKFLCTNGTIFNQKEFACDWWYNV 128
            :..|.|||...||  |.||:||||||.||:|.. ||:    ..:.|.|.|:|.|:...||.||.|
  Fly    44 IQKTSFSCAGRPA--GYYADVETGCQVYHMCDGLGRQ----FSYTCPNTTLFQQRMLICDHWYMV 102

  Fly   129 KCEEATHFYHLNA-----------DPEHNPYIPKKKPEL--EPYAND 162
            .|.:|...|..|.           |.|::...|  :|:|  .|||.|
  Fly   103 NCSKAESNYAANLLIGQRDKPFVNDEENSLRTP--RPDLLDRPYAPD 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 24/51 (47%)
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 27/59 (46%)
COG3979 336..>457 CDD:226487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.