DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG14607

DIOPT Version :10

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:101 Identity:45/101 - (44%)
Similarity:58/101 - (57%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HHEKKQDLNKIPGVPGVDYPIYHEVPHTHFSCHNVPATPGMYANVETGCQAYHVCHDGREGDQGA 105
            :::...|.:.||||||||||||.:||.|:|.|...| .||.||::|..||.:|:|...|.    .
  Fly   159 YNDSDGDYSAIPGVPGVDYPIYAQVPRTNFDCAQQP-LPGYYADIEAQCQVFHICALNRT----Y 218

  Fly   106 KFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNA 141
            .|||.|||:|:|:...|.||....|..|...|..||
  Fly   219 SFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANNA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:426342 20/49 (41%)
CG14607NP_649709.2 PRK04654 <40..137 CDD:135173
CBM_14 190..243 CDD:426342 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.