DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG14607

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:101 Identity:45/101 - (44%)
Similarity:58/101 - (57%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HHEKKQDLNKIPGVPGVDYPIYHEVPHTHFSCHNVPATPGMYANVETGCQAYHVCHDGREGDQGA 105
            :::...|.:.||||||||||||.:||.|:|.|...| .||.||::|..||.:|:|...|.    .
  Fly   159 YNDSDGDYSAIPGVPGVDYPIYAQVPRTNFDCAQQP-LPGYYADIEAQCQVFHICALNRT----Y 218

  Fly   106 KFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNA 141
            .|||.|||:|:|:...|.||....|..|...|..||
  Fly   219 SFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANNA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 20/49 (41%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.