DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG14607

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster

Alignment Length:101 Identity:45/102 (44%)
Similarity:58/102 (57%) Gaps:5/102 (5%)


  Fly    41 HHEKKQDLNKIPGVPGVDYPIYHEVPHTHFSCHNVPATPGMYANVETGCQAYHVCHDGREGDQGA 105
            :::...|.:.||||||||||||.:||.|:|.|...| .||.||::|..||.:|:|...|.    .
  Fly   159 YNDSDGDYSAIPGVPGVDYPIYAQVPRTNFDCAQQP-LPGYYADIEAQCQVFHICALNRT----Y 218

  Fly   106 KFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNA 141
            .|||.|||:|:|:...|.||....|..|...|..||
  Fly   219 SFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANNA 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 20/50 (40%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131030306
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.