DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and thw

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster


Alignment Length:158 Identity:55/158 - (34%)
Similarity:80/158 - (50%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EHPQHHEKKQDLNK---------IPGVPGVDYPIYHEVPHTHFSCHNVPATPGMYANVETGCQAY 92
            || :||.||:..::         :.|.||:|:|||..:|.|.|||.:.  ..|.:|::||.||.:
  Fly    69 EH-KHHLKKRASDEDVDYEVYQGVVGRPGIDFPIYPRIPKTSFSCRSY--GNGYFADMETDCQVF 130

  Fly    93 HVCHDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYH-----LNADPEH--NPYIP 150
            |:|.:||:    ..|||.|||||.|.|..||||:.|.|..::.:|.     ||....|  .|.:|
  Fly   131 HICEEGRK----ISFLCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEILNKQRVHRVRPSVP 191

  Fly   151 KK-----------KPELEPYANDIHDAS 167
            .:           ||::.|.|.....|:
  Fly   192 VQGFNIVGGGLNIKPKVTPVAGQGRSAA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 25/49 (51%)
thwNP_001097699.2 CBM_14 112..164 CDD:279884 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.