DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG13675

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster

Alignment Length:163 Identity:54/164 (33%)
Similarity:70/164 (43%) Gaps:39/164 (24%)


  Fly    32 NPPQPEHPQHHEKKQDL-----------------------NKIPG-VPGVDYPIYHEVPH-THFS 71
            :|.|    |.|.::|.|                       .:|.| ..|.|||.|..||. ..|:
  Fly    11 SPQQ----QQHRRQQHLQWSACIMIVVFGLFSMLAGNCVNGQIDGYTAGEDYPAYDAVPKGLAFN 71

  Fly    72 CHNVPATPGMYANVETGCQAYHVC-HDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATH 135
            |..  ..||.||:.||.||.:|.| |.|.:    ..|||.|||:|||....||||.||.||.:..
  Fly    72 CQG--RQPGYYADTETRCQVWHWCLHSGHQ----YSFLCPNGTVFNQAVRVCDWWSNVNCEGSEQ 130

  Fly   136 FYHLNADPEHNPYIPKKKPELEPYANDIHDASK 168
            .|. |.|..:.  ||:::.:|.....:..|..|
  Fly   131 LYQ-NNDELYR--IPERQQQLNDVXYEADDEYK 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 26/51 (51%)
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131030411
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.