DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG13676

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_648179.3 Gene:CG13676 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster

Alignment Length:145 Identity:39/146 (27%)
Similarity:59/146 (40%) Gaps:44/146 (30%)


  Fly    49 NKIPGVPGVD------------------YPIYHEVP---HTHFSCHNVPATPGMYANVETGCQAY 92
            :|:.|:|.:|                  ||....||   ..||.|..:  ..|.||::|..||.|
  Fly    86 SKLTGIPQIDYIWDPNLPRELRGYNLSTYPFLSTVPPMDEIHFKCEGL--HDGFYASIEYKCQIY 148

  Fly    93 HVCHDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNAD--------------- 142
            |.|..|...|    |||.|.|.|:|:.|.|.:..:|.||.:..:::.|.:               
  Fly   149 HHCVYGIRHD----FLCANFTAFDQRTFICHFASDVDCEGSQKYWNRNDELYMATTTTSTSTTTT 209

  Fly   143 --PEHNPYIPKKKPE 155
              |...|..|:::|:
  Fly   210 PAPPTLPPAPRRRPQ 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 21/50 (42%)
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.