DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32036 and CG8192

Sequence 1:NP_729504.2 Gene:CG32036 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster

Alignment Length:165 Identity:33/166 (20%)
Similarity:63/166 (38%) Gaps:47/166 (28%)


  Fly    22 IEVQKFGYLFNPPQPEHPQHHEKKQDLNKIPGVPGVDYPIYHEVPHTHFSCHNVPATPGMYANVE 86
            :::|  |.|..|...|..:..|:.::.:::..:          :..:.|||  .....|.||:..
  Fly   109 LKIQ--GQLKKPLSEESEEEEEEVEEPDRLSTL----------LSKSSFSC--TDRNSGYYADES 159

  Fly    87 TGCQAYHVCHDGREGDQGAKFLCTNGTIFNQKEFAC-----DWWYNVKCEEATHFYHLNADPEHN 146
            ..|:.:|.|.:    .|...::|..|..|:|....|     |   |: |::::. ||:..|..:.
  Fly   160 LSCEVFHYCQE----SQKHSWICPEGFTFHQIHLICMPPSHD---NI-CKQSSK-YHIVNDYLYK 215

  Fly   147 P-------------------YIPKKKPELEPYAND 162
            |                   |.|:...|.|.|.::
  Fly   216 PINLQEHQSKPNVTLRYSERYFPENYYEHERYDDE 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 14/55 (25%)
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.