DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5 and Uch

Sequence 1:NP_001261632.1 Gene:Uch-L5 FlyBaseID:FBgn0011327 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster

Alignment Length:239 Identity:62/240 (26%)
Similarity:105/240 (44%) Gaps:34/240 (14%)


  Fly     8 WCLIESDPGVFTELIREFGCDGA-QVEEIWSLDSESFKNL-EPIHGLIFLF-------------- 56
            |..:||:|.|.|:.|.:.|...| .|.::..|:.::.:.: .|:...|.||              
  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68

  Fly    57 ---KWVQEDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQC 118
               |.|:|..|        |::|:.:|..:|||.|.|::..:.|....||..| .|.:|.|....
  Fly    69 DRIKEVEEQHP--------EDLFYMRQFTHNACGTVALIHSVANNKEVDIDRG-VLKDFLEKTAS 124

  Fly   119 FDPYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLREGP 183
            ..|..:|..|....:....|.:.|:    |..|.....:..::||:..:...|.||||||.:..|
  Fly   125 LSPEERGRALEKDEKFTADHEALAQ----EGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFP 185

  Fly   184 IDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQ 227
            |..|. .||:.::.....:.::.|.| ...|:.|.::||.:.:|
  Fly   186 IKHGP-TSEETFVKDAAKVCKEFMAR-DPNEVRFTVLALTAAQQ 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5NP_001261632.1 Peptidase_C12_UCH37_BAP1 8..222 CDD:187738 60/233 (26%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87738765
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10589
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.