DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG44838 and OSTF1

DIOPT Version :9

Sequence 1:	NP_001287006.1	Gene:	CG44838 / 39099	FlyBaseID:	FBgn0266101	Length:	828	Species:	Drosophila melanogaster
Sequence 2:	XP_006717116.1	Gene:	OSTF1 / 26578	HGNCID:	8510	Length:	217	Species:	Homo sapiens

Alignment Length:	102	Identity:	27/102 - (26%)
Similarity:	38/102 - (37%)	Gaps:	30/102 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    62 SHTHLPNGSSATAAADFP-NYEATTTPQRENSSSVNSGSSVNPAHYASAAASASASVEASASAAP 125
            |.|:...|:|.......| ||.|      |.:.|::     ||.|.|:...:.|...|...:..
Human    48 SDTNWWKGTSKGRTGLIPSNYVA------EQAESID-----NPLHEAAKRGNLSWLRECLDNRV- 100

  Fly   126 TSTPGIAG--AAGSTSLTATPSSNRWPTAVATPNGHQ 160
                |:.|  .||||:|       .|    |...||:
Human   101 ----GVNGLDKAGSTAL-------YW----ACHGGHK 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG44838	NP_001287006.1	PHA03247	<67..230	CDD:223021	25/97 (26%)
CG44838	NP_001287006.1	SOG2	<184..>272	CDD:287409
OSTF1	XP_006717116.1	SH3_OSTF1	19..71	CDD:212706	8/28 (29%)
		ANK	78..192	CDD:238125	17/61 (28%)
		ANK repeat	79..106	CDD:293786	7/31 (23%)
		ANK repeat	108..140	CDD:293786	9/26 (35%)
		ANK repeat	142..173	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165155511
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930