DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44838 and OSTF1

DIOPT Version :9

Sequence 1:NP_001287006.1 Gene:CG44838 / 39099 FlyBaseID:FBgn0266101 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006717116.1 Gene:OSTF1 / 26578 HGNCID:8510 Length:217 Species:Homo sapiens


Alignment Length:102 Identity:27/102 - (26%)
Similarity:38/102 - (37%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SHTHLPNGSSATAAADFP-NYEATTTPQRENSSSVNSGSSVNPAHYASAAASASASVEASASAAP 125
            |.|:...|:|.......| ||.|      |.:.|::     ||.|.|:...:.|...|...:.. 
Human    48 SDTNWWKGTSKGRTGLIPSNYVA------EQAESID-----NPLHEAAKRGNLSWLRECLDNRV- 100

  Fly   126 TSTPGIAG--AAGSTSLTATPSSNRWPTAVATPNGHQ 160
                |:.|  .||||:|       .|    |...||:
Human   101 ----GVNGLDKAGSTAL-------YW----ACHGGHK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44838NP_001287006.1 PHA03247 <67..230 CDD:223021 25/97 (26%)
SOG2 <184..>272 CDD:287409
OSTF1XP_006717116.1 SH3_OSTF1 19..71 CDD:212706 8/28 (29%)
ANK 78..192 CDD:238125 17/61 (28%)
ANK repeat 79..106 CDD:293786 7/31 (23%)
ANK repeat 108..140 CDD:293786 9/26 (35%)
ANK repeat 142..173 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.