DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3448 and AT1G61410

Sequence 1:NP_648316.1 Gene:CG3448 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_564776.1 Gene:AT1G61410 AraportID:AT1G61410 Length:118 Species:Arabidopsis thaliana

Alignment Length:103 Identity:27/104 (26%)
Similarity:48/104 (46%) Gaps:10/104 (10%)


  Fly   130 LDAAIEAGQQ---KPQAAPATESDAQTTASLAEYEKYVRDSKLKEEELLKKFLLLLNSKKAH--- 188
            ::|.|...::   |.::....:|:|:  ..||:.||...:....|.....|||.:||:|||.   
plant     1 MEANIRLSEEVVNKTRSFEKMKSEAE--RCLAQGEKLCDEKTEFENATYAKFLSVLNAKKAKLRA 63

  Fly   189 IRDLESQLE--KRSGKVSRAKNNQRIFSDDEDDAYGAA 224
            :||.|..:.  :......:|::.:...||||.....|:
plant    64 VRDKEDSVRAVEEEESTYKAESFESGRSDDEQSGEEAS 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
AT1G61410NP_564776.1 XRCC4 <19..>110 CDD:284132 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR28559
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.