DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3448 and XRCC4

Sequence 1:NP_648316.1 Gene:CG3448 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001304941.1 Gene:XRCC4 HGNCID:12831 Length:336 Species:Homo sapiens

Alignment Length:266 Identity:55/267 (21%)
Similarity:97/267 (36%) Gaps:71/267 (27%)


  Fly     6 VKLLQRSQLSHSQIDVKPFIYVRSKWMDDDVE--FDILTTSDNQNYRSIVKYDEFRSGASELEQA 68
            :.|:....::|         :::..| :..:|  |.|..|..:..:...|...|....|.::...
Human     8 IHLVSEPSITH---------FLQVSW-EKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAME 62

  Fly    69 YDAFFAECKSAVTTHMGLQG------------FDYEISMEDVEKPAFKVYKCEGYETLYLDVPLR 121
            ...:..|.:.|:.:..|...            |.:|.:::||.      ::...:.       |.
Human    63 KGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVS------FRLGSFN-------LE 114

  Fly   122 KVSN---------CYQMLDAAIEAGQQKPQAAPATE------SDAQTTASLAEYEKYVRDSKLKE 171
            ||.|         || .||...|...:........|      :|.|     ..:||.|...:..|
Human   115 KVENPAEVIRELICY-CLDTIAENQAKNEHLQKENERLLRDWNDVQ-----GRFEKCVSAKEALE 173

  Fly   172 EELLKKFLLLLNSKKAHIRDLESQL----EKRSGKVSRAKNNQRIFSD---DEDDAYGAATQVMN 229
            .:|.|:|:|:||.||..||.|.::|    ::|. |..:.:....|.|:   |.|..|..:|    
Human   174 TDLYKRFILVLNEKKTKIRSLHNKLLNAAQERE-KDIKQEGETAICSEMTADRDPVYDEST---- 233

  Fly   230 IDNDSD 235
             |.:|:
Human   234 -DEESE 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
XRCC4NP_001304941.1 XRCC4 2..334 CDD:310912 55/267 (21%)
Interaction with LIG4 180..213 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.