DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3448 and Xrcc4

Sequence 1:NP_648316.1 Gene:CG3448 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_008758858.1 Gene:Xrcc4 RGDID:1359573 Length:334 Species:Rattus norvegicus

Alignment Length:228 Identity:56/229 (24%)
Similarity:86/229 (38%) Gaps:58/229 (25%)


  Fly    45 DNQNYRSIVKYDEFRSGASELEQAYDAFFAECKSAVTTHMGLQG------------FDYEISMED 97
            ||....|.:...|....|.::....:.:..|.:.|:....|..|            |..|..::|
  Rat    50 DNNPVSSKISESEIAQEADDMAMEQEKYMDELRRALVPESGAAGAYKFIFSKDTQHFSLEKELKD 114

  Fly    98 VEKPAFKVYKCEGYETLYLDVPLRKVSN---------CYQMLDAAIEAGQQKPQAAPATE----- 148
            |   :|::      .:..||    ||:|         || .||...|...:........|     
  Rat   115 V---SFRL------GSFNLD----KVTNPTEVIRELICY-CLDTIAEKQAKNEHLQKENERLLRD 165

  Fly   149 -SDAQTTASLAEYEKYVRDSKLKEEELLKKFLLLLNSKKAHIRDLES---QLEKRSGKVSRAKNN 209
             :|.|     ..:||.|.|.:..|.:|.::|:|:||.||..||.|.|   ||||.:.......::
  Rat   166 WTDVQ-----GRFEKCVSDKEALEADLYQRFILVLNEKKTKIRSLLSEVQQLEKSTKPERETPSS 225

  Fly   210 QRIFSDDEDDAYGAATQ------VMNIDN-DSD 235
            .:|  .:||..|..:|.      |:..|. |.|
  Rat   226 DKI--PEEDGLYDGSTDEESGAPVLGADTLDKD 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
Xrcc4XP_008758858.1 XRCC4 2..334 CDD:284132 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28559
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.