DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3448 and xrcc4

Sequence 1:NP_648316.1 Gene:CG3448 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001106551.1 Gene:xrcc4 XenbaseID:XB-GENE-943956 Length:337 Species:Xenopus tropicalis

Alignment Length:228 Identity:48/229 (21%)
Similarity:90/229 (39%) Gaps:37/229 (16%)


  Fly    26 YVRSKWMDD-DVEFDILTTSDNQNYRSIVKYDEFRSGASELEQAYDAFFAECKSA-VTTHMGLQG 88
            :::..|..| ...|.:..|.....:...|..::....|.::|.....:..|.:.| :.|.:....
 Frog    19 FLQISWKKDLGNGFAVALTDGKSAWTGEVFPEDVTQEAKDMEMERSNYVDELRKALIMTTLPANK 83

  Fly    89 FDYEISMEDVEKPAFKVYKCEGYETLYLDV-------PLRKVSN--------------CYQMLDA 132
            ::::: :||.|.|  ::|... ||....:|       .|:.|.|              |...|.:
 Frog    84 YNFDL-LEDEENP--EIYHFT-YEKKLKEVAFKLGSTKLKNVQNPAHVIRELINYCLDCTSELYS 144

  Fly   133 AIEAGQQKPQAAPATESDAQTTASLAEYEKYVRDSKLKEEELLKKFLLLLNSKKAHIRD-----L 192
            ..|..|::.:......:|..     |:.||:|...:..|.:|..:|..:||.|||.||.     |
 Frog   145 RNEHLQKENERLQCDWNDMH-----AQLEKFVNGKEELERDLYTRFTCVLNEKKAKIRSLKEKLL 204

  Fly   193 ESQLEKRSGKVSRAKNNQRIFSDDEDDAYGAAT 225
            |||...:......|.::..:..:.:.||:..:|
 Frog   205 ESQERLKQKSEETAPDDTLVAKEMKYDAFAGST 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
xrcc4NP_001106551.1 XRCC4 2..335 CDD:310912 48/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.