DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and ibpA

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_418142.1 Gene:ibpA / 948200 ECOCYCID:EG11534 Length:137 Species:Escherichia coli


Alignment Length:130 Identity:32/130 - (24%)
Similarity:58/130 - (44%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YLALVGPMEQQLRQLEKQVGASSGSSGA--VSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVE 97
            |.:.:| .::....||.....|:|....  |..:.::.:::.:.|:.|..|||.:..|||.::|:
E. coli    10 YRSAIG-FDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESELEITAQDNLLVVK 73

  Fly    98 GNHEEREDD-----HGFITRHFVRRYALPPGYEADKVASTLSSDGVLTI-------KVPKPPAIE 150
            |.|.:.:.:     .|...|:|.|::.|.   |...|......:|:|.|       :..||..||
E. coli    74 GAHADEQKERTYLYQGIAERNFERKFQLA---ENIHVRGANLVNGLLYIDLERVIPEAKKPRRIE 135

  Fly   151  150
            E. coli   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 21/89 (24%)
ibpANP_418142.1 PRK10743 1..137 CDD:182691 32/130 (25%)

Return to query results.
Submit another query.