DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT1G54400

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_175842.4 Gene:AT1G54400 / 841882 AraportID:AT1G54400 Length:183 Species:Arabidopsis thaliana


Alignment Length:39 Identity:11/39 - (28%)
Similarity:19/39 - (48%) Gaps:6/39 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 REDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTI 141
            |.:|...:..|      ||.|.:.:.:...:::.|||||
plant    24 RTEDIDILELH------LPSGLKKEHLKIQINNSGVLTI 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 11/39 (28%)
AT1G54400NP_175842.4 ACD_sHsps-like 22..100 CDD:107221 11/39 (28%)

Return to query results.
Submit another query.