DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and ACD32.1

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_172134.1 Gene:ACD32.1 / 837158 AraportID:AT1G06460 Length:285 Species:Arabidopsis thaliana


Alignment Length:89 Identity:18/89 - (20%)
Similarity:37/89 - (41%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEE--REDDHG------------FITRHFVRRYALP 121
            :.|.:::.....:::.|:|.:.::.|.|....  ::.|.|            .:...|...:.||
plant   197 YVVAIELPGASINDIRVEVDNTNLTVTGRRTSICQKVDAGTKASILGYHKQEILQGPFKVSWPLP 261

  Fly   122 PGYEADKVASTLSSDGVLTIKVPK 145
            .....|.|::.. .||:|.|.:||
plant   262 SNVNKDNVSAEF-MDGILRIVIPK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 16/87 (18%)
ACD32.1NP_172134.1 ACD_sHsps-like 189..284 CDD:107221 16/87 (18%)

Return to query results.
Submit another query.