DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT5G37670

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:87 Identity:23/87 - (26%)
Similarity:45/87 - (51%) Gaps:20/87 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MDVSHFKPSELVVKVQDNSVLV---EGNHEEREDDHGFITRH-------------FVRRYALPPG 123
            ::|..:...::.|::::.:||.   ||..||::::   :..|             |:||..||..
plant    37 INVPGYNKEDIKVQIEEGNVLSIRGEGIKEEKKEN---LVWHVAEREAFSGGGSEFLRRIELPEN 98

  Fly   124 YEADKVASTLSSDGVLTIKVPK 145
            .:.|:|.:.: .:||||:.|||
plant    99 VKVDQVKAYV-ENGVLTVVVPK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 21/85 (25%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 21/85 (25%)

Return to query results.
Submit another query.