DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT3G10680

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_187679.1 Gene:AT3G10680 / 820237 AraportID:AT3G10680 Length:490 Species:Arabidopsis thaliana


Alignment Length:77 Identity:22/77 - (28%)
Similarity:36/77 - (46%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 FVRRYALPPGYEADKVASTLSSDGVLTIKVP-------KPPAIED--KGNERIVQIQQVGPAHLN 169
            |...|.:|...:..|: ||..|.|:|||:.|       :..|::|  |..:|..|.:..||....
plant    80 FSEAYRVPDTCDMTKL-STSFSHGLLTIEFPAIVEANKQEKAVQDQEKIGQRSNQEKSGGPGPNG 143

  Fly   170 VKENPKEAVEQD 181
            .....|:|:|::
plant   144 STLGRKKALEEE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 12/37 (32%)
AT3G10680NP_187679.1 ACD_sHsps-like 32..109 CDD:107221 11/29 (38%)
PTZ00121 <149..438 CDD:173412 3/7 (43%)

Return to query results.
Submit another query.