DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and ODF1

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_077721.2 Gene:ODF1 / 4956 HGNCID:8113 Length:250 Species:Homo sapiens


Alignment Length:132 Identity:32/132 - (24%)
Similarity:57/132 - (43%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YCQRQ--RNPYLALVGPMEQQLRQLEK------QVGASSGSSGAVSKIGKDGFQVCMDVSHFKPS 83
            ||.|.  |:.....:..:|.:.|:|.|      ::.|||..|..:  :|.      ::|..|:|.
Human    81 YCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNI--LGS------VNVCGFEPD 137

  Fly    84 ELVVKVQDNSVLVEGNHEEREDDHG---FITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPK 145
            ::.|:|:|..|.|....|.|.|..|   :...:..:.::|||..:...|..:......:.|:.|.
Human   138 QVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPC 202

  Fly   146 PP 147
            .|
Human   203 YP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 18/80 (23%)
ODF1NP_077721.2 2 X 5 AA repeats of [RC]-C-L-C-D 34..77
ACD_HspB10 116..202 CDD:107237 22/93 (24%)
C-X-P repeat region 209..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.