DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb8

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:85 Identity:33/85 - (38%)
Similarity:57/85 - (67%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSS 135
            ::||::|..|||.||.||.:|..|.|.|||||::.:.|.::::|.:::.|||..:|..|.::||.
 Frog   102 WKVCVNVQTFKPEELTVKTKDGFVEVSGNHEEQQKEGGIVSKNFTKKFQLPPEVDAQTVFASLSP 166

  Fly   136 DGVLTIKVPKPPAIEDKGNE 155
            :|:|.|:.|..|....:|::
 Frog   167 EGLLIIEAPVVPPYNQQGDD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 30/73 (41%)
hspb8NP_001005658.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 86..175 CDD:469641 30/72 (42%)

Return to query results.
Submit another query.