DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb7

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:123 Identity:31/123 - (25%)
Similarity:49/123 - (39%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PMEQQLRQLEKQVG-------------ASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDN 92
            |||:.|.......|             |..|..|.:..:| |.::..:|:..|.|.:::|...:|
Mouse    39 PMEKALSMFSDDFGSFMLPHSEPLAFPARPGGQGNIKTLG-DAYEFTVDMRDFSPEDIIVTTFNN 102

  Fly    93 SVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIE 150
            .:.|..   |:....|.:...|..:..||...:...|.|.|..||.|||:..:.|..|
Mouse   103 HIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 21/77 (27%)
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ACD_HspB7_like 72..152 CDD:107234 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.