DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-16.49

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_505356.1 Gene:hsp-16.49 / 179288 WormBaseID:WBGene00002020 Length:143 Species:Caenorhabditis elegans


Alignment Length:75 Identity:27/75 - (36%)
Similarity:45/75 - (60%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSS 135
            |.|.:|||||||.:|.:::....:.:|| .:|::.:||:..|.|.:...||...:...|.|.:|:
 Worm    54 FSVQLDVSHFKPEDLKIELDGRELKIEG-IQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISN 117

  Fly   136 DGVLTIKVPK 145
            :|.|.|:.||
 Worm   118 EGKLQIEAPK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 25/73 (34%)
hsp-16.49NP_505356.1 metazoan_ACD 46..127 CDD:107247 25/73 (34%)

Return to query results.
Submit another query.