DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and cryab

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002932964.1 Gene:cryab / 100494321 XenbaseID:XB-GENE-971379 Length:173 Species:Xenopus tropicalis


Alignment Length:128 Identity:47/128 - (36%)
Similarity:68/128 - (53%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKP 82
            |:.||:..|       |:..|...::..|.::               ||.||.|.|.:||.||.|
 Frog    42 SVSPFFFRY-------PFSRLPNWIDSGLSEM---------------KIDKDRFSVNLDVKHFSP 84

  Fly    83 SELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPK 145
            .||.|||..:.:.:.|.||||:|:||:::|.|.|||.:|...:...:.||||.|||||:..|:
 Frog    85 EELNVKVLGDFIEIHGTHEERQDEHGYVSRDFQRRYKIPSDVDPQSITSTLSPDGVLTVSGPR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 37/77 (48%)
cryabXP_002932964.1 Crystallin 1..54 CDD:425732 5/18 (28%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 65..148 CDD:469641 40/98 (41%)

Return to query results.
Submit another query.