DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb3

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:85 Identity:28/85 - (32%)
Similarity:51/85 - (60%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTL 133
            |.|:|.:||..|:|.:::::|.:..::::|.|..|.|:||||:|.|.|.|.||.|.....:::..
 Frog    61 DKFKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFF 125

  Fly   134 SSDGVLTIKVPKPPAIEDKG 153
            ..||:|.::..:...:..||
 Frog   126 CHDGILAVEGKQKQGLALKG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 26/75 (35%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 26/75 (35%)

Return to query results.
Submit another query.