DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5144 and ckm

Sequence 1:NP_648284.1 Gene:CG5144 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_989374.1 Gene:ckm XenbaseID:XB-GENE-493628 Length:381 Species:Xenopus tropicalis

Alignment Length:358 Identity:154/359 (43%)
Similarity:218/359 (61%) Gaps:21/359 (6%)


  Fly    40 EKGYKKLAESKSKSLLKKHLTKEIFEKLKTKTTPSFNSTLLHCISSGMCN--HD--SGVGLYAPD 100
            |:.|..|  :|..:.:.|.|:.:|::||:.|.||| ..||...|.:|:.|  |.  ..||..|.|
 Frog    17 EEEYPDL--TKHNNHMAKALSADIYKKLRDKQTPS-GFTLDDVIQTGVDNPGHPFIMTVGCVAGD 78

  Fly   101 PEAYKVFADLFDPVIEEYHKCFKKTDKQPAT---AFGKGADFENLDPDGHFIVSTRVRCGRAVKG 162
            .|:|:||.|||||:||:.|..:|.|||....   |..||.|  :|||  ::::|:|||.||::||
 Frog    79 EESYEVFKDLFDPIIEDRHGGYKPTDKHKTDLNFANLKGGD--DLDP--NYVLSSRVRTGRSIKG 139

  Fly   163 YPFNPCLTEADYMELESKICGAVTSLTGEYKGKYMPLTGMDKCIQEQLIEDHYLF-KEGDRFLAS 226
            |...|..:..:...:|.....|::||:||:||||.||..|....|:|||:||:|| |.....|.:
 Frog   140 YALPPHCSRGERRAIEKHSIKALSSLSGEFKGKYYPLKDMSDAEQQQLIDDHFLFDKPVSPLLLA 204

  Fly   227 AGASRYWPTGRGIFLNSAKNFLVWCNEEDHIRIISMEKGGDLGKVYDRMVGG---VEALGKQL-- 286
            :|..|.||..|||:.|..|.||||.|||||:|:|||:|||::.:|:.|...|   :|.:.||.  
 Frog   205 SGMGRDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCEGLQKIEEIFKQAGH 269

  Fly   287 QFNRDERLGFLTFCPTNLGTSIRASVHIKLPNLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGV 351
            .|..:|.||::..||:||||.:|..||.|||||...| :..::..:.|||.|||.|..:.|.|||
 Frog   270 PFMWNEHLGYVLTCPSNLGTGLRGGVHAKLPNLSKHP-KFDEILGRLRLQKRGTGGVDTAAVGGV 333

  Fly   352 HDISNQRRMGLTEYEIIKEMHDGIKGLIEAECK 384
            .||||..|:|.:|.:.::.:.||:|.:||.|.|
 Frog   334 FDISNADRLGFSEVDQVQMVVDGVKLMIEMEKK 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 152/355 (43%)
ckmNP_989374.1 creatine_kinase_like 16..373 CDD:153076 154/359 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55467421
eggNOG 1 0.900 E1_COG3869
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2621
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D287050at33208
OrthoFinder 1 1.000 FOG0000287
OrthoInspector 1 1.000 T129198
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.850

Return to query results.
Submit another query.