DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5144 and F46H5.3

Sequence 1:NP_648284.1 Gene:CG5144 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_509217.2 Gene:F46H5.3 WormBaseID:WBGene00018519 Length:396 Species:Caenorhabditis elegans

Alignment Length:401 Identity:213/402 (53%)
Similarity:285/402 (71%) Gaps:28/402 (7%)


  Fly     2 LLHLKLRLELQLLGR---------------CAQLVINRHASKG-NVDKEVMEQMEKGYKKL-AES 49
            :||...|:..|.|||               |.|      |.:| :|..:|:.::|:||.|| |..
 Worm     1 MLHRCSRVLSQFLGRGNSKMLREAYSTSLHCVQ------AQEGMSVSPDVIAKIEEGYAKLQAAP 59

  Fly    50 KSKSLLKKHLTKEIFEKLKTKTTPSFNSTLLHCISSGMCNHDSGVGLYAPDPEAYKVFADLFDPV 114
            :..|||||:||||:.::||.|.| ...:.||..|.||:.|.|||||:||||.|||.:|..||||:
 Worm    60 ECHSLLKKYLTKEVVDQLKDKKT-KLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPL 123

  Fly   115 IEEYHKCFKKTDKQPATAFGKG--ADFENLDPDGHFIVSTRVRCGRAVKGYPFNPCLTEADYMEL 177
            |::||..|....|||.|..|:|  :...:|||:|.||.|||:||||:::||||||||:||:|:|:
 Worm   124 IQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEM 188

  Fly   178 ESKICGAVTSLTG-EYKGKYMPLTGMDKCIQEQLIEDHYLFKEGDRFLASAGASRYWPTGRGIFL 241
            |||:.....::|. |..|||.||.||.|.||:|||:||:|||||||||.:|.|.||||.|||||.
 Worm   189 ESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFH 253

  Fly   242 NSAKNFLVWCNEEDHIRIISMEKGGDLGKVYDRMVGGVEALGKQLQFNRDERLGFLTFCPTNLGT 306
            |:.|.||:|||||||:|||||::||::|:|.:|::.||:.:.||..|:||:|||:|||||:||||
 Worm   254 NNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGT 318

  Fly   307 SIRASVHIKLPNLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHDISNQRRMGLTEYEIIKEM 371
            ::||||||:||.:...|| .|.:.|..:|||||..|||||::|||:||||:.|:||||:|.:|:|
 Worm   319 TVRASVHIRLPKISAKPD-FKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQM 382

  Fly   372 HDGIKGLIEAE 382
            :|||..||..|
 Worm   383 YDGIAHLIALE 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 199/346 (58%)
F46H5.3NP_509217.2 arginine_kinase_like 47..396 CDD:153079 200/350 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55219145
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 466 1.000 Inparanoid score I845
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D287050at33208
OrthoFinder 1 1.000 FOG0000287
OrthoInspector 1 1.000 T98027
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11547
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.