DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Doc2 and byn

Sequence 1:NP_648282.1 Gene:Doc2 FlyBaseID:FBgn0035956 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:599 Identity:160/600 (27%)
Similarity:229/600 (38%) Gaps:205/600 (34%)


  Fly    56 VEMTLQNDDLWKQFHQIGTEMIITKSGRRMFPSMRLSVSGLEDESNYCVLLEMVPIGDCRYKFSG 120
            :.::|.:.:||.:|..:..|||:||:||||||.:::|.|||:..:.|.||||.|.|...|:|:..
  Fly    87 LRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWKYVN 151

  Fly   121 SQWVPAGGAE--PQSPQRMYLHPDSPATGAHWQAQPILFNKVKLTNNTLDNSGHIVLASMHKYQP 183
            .:|||.|.||  |.:|  :|:||:||..||||..:||.|.||||||.| :.:|.|:|.|:|||:|
  Fly   152 GEWVPGGKAEVPPSNP--IYVHPESPNFGAHWMKEPISFAKVKLTNKT-NGNGQIMLNSLHKYEP 213

  Fly   184 RLHVIRTADLAQIPWAPQQAFV----FAETEFVAVTAYQNDRITKLKIDNNPFAKGFRET----- 239
            |:|::|...        :|..|    |.||:|:|||||||:.:|.|||..|||||.|.:.     
  Fly   214 RVHLVRVGS--------EQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDAKERPD 270

  Fly   240 ----------------------------------------------------------------G 240
                                                                            |
  Fly   271 TLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGSCDRYG 335

  Fly   241 QSRCKRKM---------------------------SSSPTGEDQDQSPSLSHSQSQS--ESDMSP 276
            :|...|.:                           |:||......|:|:..||.|..  .:.:|.
  Fly   336 RSLSSRSVAPTRTTPYSRPRVVSGSGSNGSAGNASSTSPQPPSAPQTPTSLHSTSTGSVSTSVSS 400

  Fly   277 TKGGG-----ETAGGTSSIGDSDGPQI------------KRLRSNG--------------SACS- 309
            :.|||     .|...:||...|....:            ...:|||              :.|| 
  Fly   401 SSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQSNGNYWNATSVPGPMPMNVCSG 465

  Fly   310 --LSSSLDDQSVPGASSLALGSPP---PHLHSHSHPH-----------------------PLQAR 346
              :||........|:.|....||.   .||..|||.:                       |..|.
  Fly   466 RNISSHNSPSPTNGSPSYTTSSPSYTIHHLTPHSHQYNMAQTDIYGTGVGVGGGAGTTGSPQAAY 530

  Fly   347 SASSVFMQH-------FQQNMQSLLR-PSLVDLACT--YFGRPHEYG-----GAIQASPMYPPAA 396
            .|::..:.|       .|....::|. ||.:..:.:  :.|...|||     .|....|.|.|  
  Fly   531 GAAAHQVYHPTPTSPTHQLYTNAVLNAPSALSYSASGWHNGSGAEYGLYQNAAAAYYQPEYIP-- 593

  Fly   397 MLQAGLGPHPGLNLPPGVSGADLISDESGAEELELDVGSETSTLE------QSTQEQPLEQPSTR 455
             |:.|...||   |.| |..:..:.|...|.....|......|||      :|:.:..:|..|..
  Fly   594 -LEIGYATHP---LEP-VDVSKTLDDPQAAMYKPSDEQGSVITLECASSSLKSSHDIKIESSSLE 653

  Fly   456 SKGFSISAILGGGS 469
            ..|  ....:|||:
  Fly   654 HAG--ERGTVGGGA 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Doc2NP_648282.1 TBOX 55..242 CDD:238106 90/261 (34%)
bynNP_524031.2 TBOX 86..268 CDD:238106 89/192 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11267
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.