DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5280 and RGD1359634

DIOPT Version :8

Sequence 1:NP_648278.1 Gene:CG5280 / 39033 FlyBaseID:FBgn0035952 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_017450358.1 Gene:RGD1359634 / 315126 RGDID:1359634 Length:256 Species:Rattus norvegicus

Alignment Length:174 Identity:50/175 (29%)
Similarity:83/175 (47%) Gaps:23/175 (13%)


  Fly    37 PMWPSERIP--PGGAGAFHSAKVQ--YSKETADLIRLLVKESKMSMLVRKQIDESLRNGEPLPLP 97
            ||...||:.  ..|.| ||..:.|  |:..|.:|:|:::||||::...::.|.::::.|.||||.
  Rat     4 PMASQERVDAVANGTG-FHRCRKQAAYTPGTCELLRVMMKESKLTNFQQRHIMDTMKRGAPLPLQ 67

  Fly    98 EPPRPNTNNDPDKETLA------ILDRARNAKRKNLRQIEASGAYKQSYYRPPADNRMHGEKAKS 156
            ..|..:....|.|::.|      ||....:.:..:|.|  |:|||.:..::|.|...:..||.:.
  Rat    68 CNPTSSQRGSPSKKSAAAIYLPPILATHTHLRPASLCQ--ANGAYSREQFKPQATRDLEKEKRRL 130

  Fly   157 QLQFTMAGTHLPDPAIKPRRRPREEQLVTEEDLINELLDQINER 200
            |..|...         |.....::...|.:||...| ||:.:||
  Rat   131 QNIFATG---------KDMEERKKVPHVQQEDPAPE-LDRFDER 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5280NP_648278.1 UPF0193 40..241 CDD:283026 48/172 (28%)
RGD1359634XP_017450358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181442463
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4973
OMA 1 1.010
OrthoDB 1 1.010 D1195866at2759
OrthoFinder 1 1.000 FOG0007231
OrthoInspector 1 1.000 T1088448
orthoMCL 1 0.900 OOG5_134355
Panther 1 1.100 LDO PTHR28348
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.