DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5280 and 1700088E04Rik

DIOPT Version :9

Sequence 1:NP_648278.1 Gene:CG5280 / 39033 FlyBaseID:FBgn0035952 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_613047.1 Gene:1700088E04Rik / 27660 MGIID:1920774 Length:216 Species:Mus musculus


Alignment Length:212 Identity:63/212 - (29%)
Similarity:109/212 - (51%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MWPSERIPPGGAG-AFHSAKVQ--YSKETADLIRLLVKESKMSMLVRKQIDESLRNGEPLPLPEP 99
            |...||:.....| .|...:.|  |:..|.:|:|:::||||::...::.|.::::.|.||||...
Mouse     1 MASQERVDSVTKGTGFRRCRKQAGYTPGTCELLRVMMKESKLTNFQQRHIMDTMKRGAPLPLQCN 65

  Fly   100 PRPNTNNDPDKETLA------ILDRARNAKRKNLRQ---IEASGAYKQSYYRPPADNRMHGEKAK 155
            |..:....|.|:..:      ||     |...:||.   .:|:|||.:..::|.|...:  ||.|
Mouse    66 PTSSLRGSPSKKAASAIYLPPIL-----ATHSHLRPASLCQANGAYSREQFKPQATRDL--EKEK 123

  Fly   156 SQLQFTMAGTHLPDPAIKPRRRPREEQLVTEEDLINELLDQINERAEWLTEMESMGQGKKYRPEI 220
            .:||...| |.......|.....|:|....|.|..:||:.:|.:|.|:|..||::|||::||..|
Mouse   124 RRLQNIFA-TGKDKEERKKVPHVRQEDPAPELDRFDELVKEIQDRKEFLAAMEALGQGRQYRSII 187

  Fly   221 RDQIAERLRRIQALESK 237
            ..:|:::||.::.::.:
Mouse   188 LAEISQKLREMEDIDRR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5280NP_648278.1 UPF0193 40..241 CDD:283026 62/210 (30%)
1700088E04RikNP_613047.1 UPF0193 6..211 CDD:283026 61/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850497
Domainoid 1 1.000 86 1.000 Domainoid score I8125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5151
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52348
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007385
OrthoInspector 1 1.000 - - oto94481
orthoMCL 1 0.900 - - OOG6_106698
Panther 1 1.100 - - LDO PTHR28348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.