DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and PAO1

DIOPT Version :10

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_196874.1 Gene:PAO1 / 831215 AraportID:AT5G13700 Length:472 Species:Arabidopsis thaliana


Alignment Length:123 Identity:25/123 - (20%)
Similarity:47/123 - (38%) Gaps:21/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RSRQVHNVVSMSDY---EGDFVYKGNDLELCFSDEKWKFATAQNTPRLLHHHSANNRYYVMQSPA 273
            ::::..:|..:..:   |.:.:.|..|:     .|:.:..|....|.:|...|::.        .
plant    46 KAKETEDVPPLEAFIVSESESIPKAKDV-----IEEREVQTPPAIPAVLSDPSSDT--------D 97

  Fly   274 KSVGGKALCDYESSVSTPG---YMEKTKSFKAKVRS--HSAPRQRSERQRLSLDEVMA 326
            |||..|:..|.|......|   ..|.:....:|.||  ...|.:..|::..|..|:.|
plant    98 KSVTPKSQKDCEEEKPQDGEDNVQEASAEKASKPRSIVQPNPVEEKEQKEESKKEIPA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 Amino_oxidase 17..466 CDD:396255 25/123 (20%)
PAO1NP_196874.1 PLN02676 20..447 CDD:215362 25/123 (20%)

Return to query results.
Submit another query.