| Sequence 1: | NP_648269.1 | Gene: | CG5653 / 39024 | FlyBaseID: | FBgn0035943 | Length: | 476 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_196874.1 | Gene: | PAO1 / 831215 | AraportID: | AT5G13700 | Length: | 472 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 491 | Identity: | 132/491 - (26%) | 
|---|---|---|---|
| Similarity: | 221/491 - (45%) | Gaps: | 90/491 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     6 ASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQW---CHGK 67 
  Fly    68 QQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVVGSFGTH 132 
  Fly   133 LTQTFWRKIESELPQVNRDVASEALNT----------FAKHESSIIGADNLFEVSVREHIEYHEC 187 
  Fly   188 DGDK-LLHWGTKGYRRFLRLLMKVSADTPEEL------GLLEGRIQLDMKVIKIELACPRKVILR 245 
  Fly   246 CQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGW 310 
  Fly   311 VGFFCFWL----EEDLI---ELRKTEYFWVEGITGVHMITCQP--RMLMAWVNGPHGRHMETLSD 366 
  Fly   367 EKVLEGLYWLFRKFLTFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLGED 431 
  Fly   432 GHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLID 467  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5653 | NP_648269.1 | NAD_binding_8 | 12..78 | CDD:290186 | 35/68 (51%) | 
| Amino_oxidase | 17..466 | CDD:279874 | 125/477 (26%) | ||
| PAO1 | NP_196874.1 | PLN02676 | 20..447 | CDD:215362 | 121/473 (26%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D508351at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 3 | 2.880 | |||||