DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and PAO1

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_196874.1 Gene:PAO1 AraportID:AT5G13700 Length:472 Species:Arabidopsis thaliana

Alignment Length:491 Identity:132/492 (27%)
Similarity:221/492 (45%) Gaps:90/492 (18%)


  Fly     6 ASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQW---CHGK 67
            :::.:||||||:|||:||..|::|..::|.||||.|||||||:...|||..::|||.|   ..||
plant     2 STASVIIIGAGISGISAAKVLVENGVEDVLILEATDRIGGRIHKQNFGDVPVELGAGWIAGVGGK 66

  Fly    68 QQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVVGSFGTH 132
            :.|.|:::.....:.....||    ...|.|           |:|.:.|..|:|   :.......
plant    67 ESNPVWELASRFNLRTCFSDY----TNARFN-----------IYDRSGKIFPTG---IASDSYKK 113

  Fly   133 LTQTFWRKIESELPQVNRDVASEALNT----------FAKHESSIIGADNLFEVSVREHIEYHEC 187
            ...:...|::|...|.:..||.||.::          |..|:         ||::..|.|..:..
plant   114 AVDSAILKLKSLEAQCSGQVAEEAPSSPKTPIELAIDFILHD---------FEMAEVEPISTYVD 169

  Fly   188 DGDK-LLHWGTKGYRRFLRLLMKVSADTPEEL------GLLEGRIQLDMKVIKIELACPRKVILR 245
            .|:: .|....:||.   .||.|::    ||.      .:|:.|::|:..|.:::.: ...|:::
plant   170 FGEREFLVADERGYE---CLLYKMA----EEFLVTSHGNILDYRLKLNQVVREVQQS-RNGVVVK 226

  Fly   246 CQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGW 310
            .:||..:||::||.:.|:||||..... |.|.||..|..||:...:....|::|::.:       
plant   227 TEDGSVYEANYVIVSASIGVLQSDLLS-FQPLLPRWKTEAIQKCDVMVYTKIFLKFPQ------- 283

  Fly   311 VGFFCFWL----EEDLI---ELRKTEYFWVEGITGVHMITCQP--RMLMAWVNGPHGRHMETLSD 366
                |||.    :|..|   |.|....||      .||....|  .:|:..:.....:.:|..||
plant   284 ----CFWPCGPGQEFFIYAHEQRGYFTFW------QHMENAYPGSNILVVTLTNEQSKRVEAQSD 338

  Fly   367 EKVLEGLYWLFRKFLTFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLGED 431
            ::.::....:.|......||.....:...|::|...|||:|...:::|  |....::::||    
plant   339 QETMKEAMSVLRDMFGATIPYATDILVPRWWNNRFQRGSYSNYPMISD--NQLLQNIKAPV---- 397

  Fly   432 GHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLID 467
            |.  :.|.||.:|......|||...||...:..|::
plant   398 GR--IFFTGEHTSEKFSGYVHGGYLAGIDTSKSLLE 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 35/69 (51%)
Amino_oxidase 17..466 CDD:279874 126/478 (26%)
PAO1NP_196874.1 PLN02676 20..447 CDD:215362 121/474 (26%)
NAD_binding_8 <22..78 CDD:290186 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D508351at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.