DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and PAO5

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_194701.1 Gene:PAO5 AraportID:AT4G29720 Length:533 Species:Arabidopsis thaliana

Alignment Length:550 Identity:162/550 (29%)
Similarity:242/550 (44%) Gaps:113/550 (21%)


  Fly     8 SRIIIIGAGVSGIAAATRLL--QNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQN 70
            :||:|||||::|:.||.:|.  .||...:.::|...||||||||..|....|::||.|.||...:
plant     5 ARIVIIGAGMAGLTAANKLYTSSNNTFELSVVEGGSRIGGRINTSEFSSEKIEMGATWIHGIGGS 69

  Fly    71 CVYDMVKDMG-------------------------------ILHETGDYYSPIKRVRSNKEVVPH 104
            .||.:.|:.|                               |:......::.:..:...||:...
plant    70 PVYRIAKETGSLVSDEPWECMDSTIDKAKTFAEGGFEIEPSIVESISGLFTALMELAQGKEISQS 134

  Fly   105 EL----ACRIHDIAVKSMPSGPHPVVGSFGTHLTQTFWRKIES-------ELPQVNRDVASEALN 158
            :.    ...|::.|.:....|....||||.......:|..|.:       ...:.:|....||:.
plant   135 DADLSRLAHIYETATRVCSKGSSTSVGSFLKSGFDAYWDSISNGGEEGVKGYGKWSRKSLEEAIF 199

  Fly   159 T-FAKHESSIIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLE 222
            | |:..:.:...||.|..:......||....|:::..  .|||...:..|..|         |.:
plant   200 TMFSNTQRTYTSADELSTLDFAAESEYQMFPGEEITI--AKGYLSVIHHLASV---------LPQ 253

  Fly   223 GRIQLDMKVIKIELACPRKVILRCQDGDYFEADHVICTVSLGVLQ---EQHEKLFVPPLPAAKVN 284
            |.|||:.||.|||.. ..:|.|...||....|||||.|||||||:   |...:||.||||..|.:
plant   254 GVIQLNRKVTKIEWQ-SNEVKLHFSDGSVVFADHVIVTVSLGVLKAGIETDAELFSPPLPDFKSD 317

  Fly   285 AIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDLIELRKTEYFW----VEGITGVHMITCQ 345
            |||.|..|.||||::|..::..|...:.|     :.:..|.|..:..|    ...||.:|   ..
plant   318 AIRRLGYGVVNKLFVEMSQRKFPSLQLVF-----DREDSEFRFVKIPWWMRRTATITPIH---SN 374

  Fly   346 PRMLMAWVNGPHGRHMETLSDEK----VLEGLYWLFRKFLTFEIPPP---------------KRF 391
            .::|::|..|.....:|.|:||:    |:..:..|..|.:..:...|               .:.
plant   375 SKVLLSWFAGKEALELEKLTDEEIKDAVMTTISCLTGKEVKNDTAKPLTNGSLNDDDEAMKITKV 439

  Fly   392 VRSSWFSNPNFRGSWSYRGV---------MADERNTGPWDLESPVLGE-DGH-------LGLLFA 439
            ::|.|.|:|.||||:||..|         ||:     |....:..:|: :||       |.::||
plant   440 LKSKWGSDPLFRGSYSYVAVGSSGDDLDAMAE-----PLPKINKKVGQVNGHDQAKVHELQVMFA 499

  Fly   440 GEASSRNHFSTVHGAVEAGYREADRLIDHY 469
            |||:.|.|:||.|||..:|.|||:||:.||
plant   500 GEATHRTHYSTTHGAYYSGLREANRLLKHY 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 30/68 (44%)
Amino_oxidase 17..466 CDD:279874 153/537 (28%)
PAO5NP_194701.1 PLN02568 1..533 CDD:215308 162/550 (29%)
NAD_binding_8 9..77 CDD:290186 30/68 (44%)
NADB_Rossmann <251..>288 CDD:304358 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I1436
OMA 1 1.010
OrthoDB 1 1.010 D508351at2759
OrthoInspector 1 1.000 T124897
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
66.170

Return to query results.
Submit another query.