DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and SMOX

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001257620.1 Gene:SMOX HGNCID:15862 Length:585 Species:Homo sapiens

Alignment Length:592 Identity:167/593 (28%)
Similarity:243/593 (41%) Gaps:163/593 (27%)


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ 69
            |...|:::||||::|:|||..||:..|.:|.:|||...||||:.:|..|....:|||.|.||...
Human    22 RGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHG 86

  Fly    70 NCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRI--HDIAVKSMPSGPHPVVGSFGT- 131
            |.:|.:.:..|:|.||.|....:.|:....:   :.:||.:  |...:      |..||..|.. 
Human    87 NPIYHLAEANGLLEETTDGERSVGRISLYSK---NGVACYLTNHGRRI------PKDVVEEFSDL 142

  Fly   132 -----HLTQTFWR-------------------------KIESELPQVNRDVASEALNTFAKHESS 166
                 :|||.|:|                         :.:.:.|:..:.:....:..:.|.||.
Human   143 YNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESC 207

  Fly   167 IIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKV 231
            ...:.::.|||:....|:.|..|..  |....|:.|.:.||.:         |:....|||...|
Human   208 ESSSHSMDEVSLSAFGEWTEIPGAH--HIIPSGFMRVVELLAE---------GIPAHVIQLGKPV 261

  Fly   232 IKIE----LACPR-------------------------------------KVILRCQDGDYFEAD 255
            ..|.    .|.||                                     .|::.|:|.:...||
Human   262 RCIHWDQASARPRGPEIEPRGEGDHNHDTGEGGQGGEEPRGGRWDEDEQWSVVVECEDCELIPAD 326

  Fly   256 HVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFW--- 317
            |||.|||||||:.|:...|.|.||..||.||..|.:||.:|::||:|:.           ||   
Human   327 HVIVTVSLGVLKRQYTSFFRPGLPTEKVAAIHRLGIGTTDKIFLEFEEP-----------FWGPE 380

  Fly   318 ------LEEDLIELRKTEY---FWVEGITGVHMITCQPR---MLMAWVNGPHGRHMETLSDEKVL 370
                  :.||..|.....|   .|...|.|..::....|   :|..|:.|.....||...||.|.
Human   381 CNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERYGHVLSGWICGEEALVMEKCDDEAVA 445

  Fly   371 EGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLE---------- 424
            |....:.|:|. ...||.|:|.:||:|.|||.||||:||..|     .:...|:|          
Human   446 EICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQV-----GSSGADVEKLAKPLPYTE 505

  Fly   425 -------SPVLGEDGHL--------------------GLLFAGEASSRNHFSTVHGAVEAGYREA 462
                   |....:.|||                    .:||:|||:.|.::||.|||:.:|.|||
Human   506 SSKTAHGSSTKQQPGHLFSSKCPEQPLDANRGAVKPMQVLFSGEATHRKYYSTTHGALLSGQREA 570

  Fly   463 DRLIDHY 469
            .|||:.|
Human   571 ARLIEMY 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 29/66 (44%)
Amino_oxidase 17..466 CDD:279874 159/576 (28%)
SMOXNP_001257620.1 NAD_binding_8 <45..88 CDD:290186 18/43 (42%)
PLN02568 50..578 CDD:215308 154/565 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117597225
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.