DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and paox

DIOPT Version :9

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001011373.1 Gene:paox / 496840 XenbaseID:XB-GENE-946701 Length:301 Species:Xenopus tropicalis


Alignment Length:309 Identity:79/309 - (25%)
Similarity:125/309 - (40%) Gaps:73/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHG-KQQNCVY 73
            ::|||||:||:|||.:|.:..|:|.:||||..|.||||.:..:...::::||||.|| ...|.|:
 Frog     8 VLIIGAGISGLAAAQKLHERGFRNFRILEATGRSGGRIRSRKYAKGLVEIGAQWIHGPSPSNPVF 72

  Fly    74 DMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSG----------------- 121
            .:.....:|..     ..:.......|:..|.:...|:..:.|.:..|                 
 Frog    73 QLSTQYNLLSS-----EALSEENQLVELEGHPMFSVIYSSSGKQINRGVGENVVEMFSSWLQKSR 132

  Fly   122 --------PHPVVGSFGTHLTQTF------WRKIESELPQVNRDVASEALNTFAKHESSIIGADN 172
                    |...||||   |.|..      |.:...||...       .|:...|.|..|.|..:
 Frog   133 EFTKGGCNPEESVGSF---LRQEICNSYSNWERDSLELKMA-------LLSGLFKLECCISGTHS 187

  Fly   173 LFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQL---------- 227
            :..|::....||....|  |.....:||.   .|:..:.|..|.:..||...::.          
 Frog   188 MDYVALSSCGEYEMLPG--LDCTFPRGYE---SLVDHIKASFPSDNVLLNKPVKTINWKGSFSGS 247

  Fly   228 DMKVIKIELACPRKVILRCQDGDYFEADHVICTVSLG---VLQEQHEKL 273
            |.::..::        :.|::|:.|.|||||.||.||   |:.|.:.|:
 Frog   248 DSRIYPVQ--------VECENGETFVADHVILTVPLGIGPVIWENYGKV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 30/66 (45%)
Amino_oxidase 17..466 CDD:279874 74/302 (25%)
paoxNP_001011373.1 Amino_oxidase 6..>277 CDD:332356 75/296 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375579at33208
OrthoFinder 1 1.000 - - FOG0000632
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.