DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and CG8032

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001262380.1 Gene:CG8032 FlyBaseID:FBgn0037606 Length:583 Species:Drosophila melanogaster

Alignment Length:545 Identity:148/546 (27%)
Similarity:226/546 (41%) Gaps:116/546 (21%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDN-VIDLGAQWCHGKQQNCV 72
            :|:|||||::|::||..||||...:..||||..|:||||.::...:| .|:|||.|.||...|.:
  Fly    41 KIVIIGAGMAGLSAANHLLQNGCDDFLILEARGRVGGRIVSIPLSNNQKIELGANWIHGVLGNPI 105

  Fly    73 YDMVKDMGILHETGDYYSPIKRVRSNKE--VVPHELACRIHDIAVKSM---------PSGPHPVV 126
            :::....|:: ...:...|.|.|.:.::  .||..:...|::..|..:         ...|.|.:
  Fly   106 FELAVQHGLV-SVVNVPKPHKVVATTEDGHQVPFNILQEIYEAYVCFLRRCDEYFLCQYSPPPDI 169

  Fly   127 GSFGTHLTQTFWRKIESELPQV----NRDVASEALNTFAKHESSIIGADNLFEVSVREHIEYHEC 187
            .|.|.|:..    :||..|..|    .:.:.....|...|.|:.|.|.:|:.||.:.|...|.|.
  Fly   170 HSVGEHINY----EIEIYLSGVQDPKEKRLKQSIFNCLLKRETCITGCNNMDEVDLLELGSYTEL 230

  Fly   188 DGD------------------------------KLLHWGTKGYRRFLRLL--------------- 207
            .|.                              |.:||..|  :.|..|.               
  Fly   231 QGGNIVLPTGYSSILRPLGAQIAKQSILTKCPVKKIHWKRK--KTFTGLETVDENSEDEHSDDSE 293

  Fly   208 -------------MKVSADTPEELGLLEGRIQLDMKVIKIELACPRKVILRCQDGDYFEADHVIC 259
                         ..|.::|........|.:::|                 |:||..|.|.||||
  Fly   294 RTVTEVPTGEIRGASVESNTSSNCDYPAGNVRID-----------------CEDGRVFHAAHVIC 341

  Fly   260 TVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDLIE 324
            |:.||||:..|..||.|.||..|..:|.:|..|||:|::||||:..|..........| ::|..:
  Fly   342 TIPLGVLKNTHRTLFDPVLPQYKQESIENLMFGTVDKIFLEYERPFLSADISEIMLLW-DDDKRD 405

  Fly   325 LRKTE-------YF---WVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRK 379
            :..:|       |.   |.:.|.....:|  ..:|:.||:|....:||.|..|.|.|....:.|.
  Fly   406 MNSSEEELASEAYLSKNWFKKIYSFAKVT--DTLLLGWVSGREAEYMEKLDHEAVAEKCTEILRN 468

  Fly   380 FLTFE-IPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLGEDGHL--GLLFAGE 441
            ||... :|.|||.|.:||.|. :|.|. :|..:..........:|..|:......:  .::||||
  Fly   469 FLQDPYVPKPKRCVCTSWKSQ-DFTGG-AYTSIPVGATQEDIENLAQPLYATPQAMKPAIVFAGE 531

  Fly   442 ASSRNHFSTVHGAVEAGYREADRLI 466
            .:..:.:||||||..:|...|..|:
  Fly   532 HTHSSFYSTVHGAYLSGRTAAQHLL 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 30/67 (45%)
Amino_oxidase 17..466 CDD:279874 142/536 (26%)
CG8032NP_001262380.1 NAD_binding_8 44..104 CDD:290186 30/60 (50%)
Amino_oxidase 49..556 CDD:279874 142/536 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117599299
eggNOG 1 0.900 E1_KOG0685
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10742
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.