DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and Su(var)3-3

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_649194.1 Gene:Su(var)3-3 FlyBaseID:FBgn0260397 Length:890 Species:Drosophila melanogaster

Alignment Length:611 Identity:146/612 (24%)
Similarity:242/612 (40%) Gaps:198/612 (32%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQNCVY 73
            ::|:||||:||:|.|.:|.|.. .:|.:|||.||:||||:|......:.|:||....|...|.:.
  Fly   266 KVIVIGAGISGLAVAHQLQQFG-MDVIVLEARDRVGGRISTFRKNSYIADVGAMVVTGVYGNPMT 329

  Fly    74 DMVKDMGI----LHETGDYYSP----------------IKRVRSNKEVVPHEL------ACRIH- 111
            .:.|.:|:    :.:|...|.|                ..|:..:...:.|.|      .|.:. 
  Fly   330 ILSKQIGMDLVPIQQTCPLYGPDGKPVPKEKDDVIEREFNRLLESASYLSHRLDFNYAGDCPVSL 394

  Fly   112 ------DIAVKSMPSGPHPVVGSFGTHL-----TQTFWRKIESELPQVN--RDVASEALNTFAKH 163
                  .|:::.|     .|:...|.|:     |||   ||..:..::.  ||...:..|   :|
  Fly   395 GDALEWIISMQEM-----QVMHKRGQHMQEIIATQT---KIIEQRRRLKTLRDTIGKLKN---EH 448

  Fly   164 ESSI-----IGAD----------NL--FEVSVREHIE-YHECDGDKLLHWGTKGYRRFLRLLMKV 210
            .:.|     .|.|          |:  .::.:.|.|. :|:...::         ::.|..|.::
  Fly   449 LAMINQRKPKGTDGDLKYCYQEFNIRNTQIKMEETISTFHDLHAEE---------KQMLAKLHEL 504

  Fly   211 SADTPEELGL-LEGRIQLDMKVIKIELACPRK---VILR--CQDGDY------------------ 251
            ..:.|.::.| ...|:.||.....:|.|...:   :.|:  .||.|:                  
  Fly   505 EQNRPSDVYLSSRDRLILDWHFANLEFANATRLNNLSLKHWDQDDDFEFIGHHTTVRNGYSCVPV 569

  Fly   252 ---------------------------------------FEADHVICTVSLGVL---------QE 268
                                                   ::||.|:||::||||         |:
  Fly   570 ALTENLDIRVNSAVKEIKYGTKGVEVVAENLKTSNSQMTYKADLVVCTLTLGVLKVAVAHKESQQ 634

  Fly   269 QHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEK---QPLPD--GWVG--------FFCFWLEE 320
            .:...|.||||..|..||:.|..|.:||:.|.:::   .|..:  |.||        .|.||   
  Fly   635 SNTVKFDPPLPDWKQQAIKRLGFGNLNKVVLCFDRIFWDPNANLFGHVGSTTASRGEMFLFW--- 696

  Fly   321 DLIELRKTEYFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRK-FLTFE 384
                                .|:..| :|:|.|.|.....:|:::|:.::.....:.:. |....
  Fly   697 --------------------SISSSP-VLLALVAGMAANLVESVTDDIIIGRCMSVLKNIFGNTS 740

  Fly   385 IPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWD-LESPVL-----GEDGHLGLLFAGEAS 443
            :|.||..|.:.|.|:|..|||:||..|.:   :...:| |.:||:     ..:|...|.||||.:
  Fly   741 VPQPKETVVTRWRSDPWARGSYSYVSVGS---SGSDYDLLAAPVIPPSSKDAEGLPRLFFAGEHT 802

  Fly   444 SRNHFSTVHGAVEAGYREADRLIDHY 469
            .||:.:|||||..:|.|||.|:.|:|
  Fly   803 IRNYPATVHGAYLSGLREAGRIADYY 828

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 27/66 (41%)
Amino_oxidase 17..466 CDD:279874 139/599 (23%)
Su(var)3-3NP_649194.1 SWIRM 165..250 CDD:282311
NAD_binding_8 269..327 CDD:290186 26/59 (44%)
Amino_oxidase 274..824 CDD:279874 139/598 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117592312
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10742
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.