| Sequence 1: | NP_648269.1 | Gene: | CG5653 / 39024 | FlyBaseID: | FBgn0035943 | Length: | 476 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649194.1 | Gene: | Su(var)3-3 / 40217 | FlyBaseID: | FBgn0260397 | Length: | 890 | Species: | Drosophila melanogaster | 
| Alignment Length: | 611 | Identity: | 146/611 - (23%) | 
|---|---|---|---|
| Similarity: | 242/611 - (39%) | Gaps: | 198/611 - (32%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     9 RIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQNCVY 73 
  Fly    74 DMVKDMGI----LHETGDYYSP----------------IKRVRSNKEVVPHEL------ACRIH- 111 
  Fly   112 ------DIAVKSMPSGPHPVVGSFGTHL-----TQTFWRKIESELPQVN--RDVASEALNTFAKH 163 
  Fly   164 ESSI-----IGAD----------NL--FEVSVREHIE-YHECDGDKLLHWGTKGYRRFLRLLMKV 210 
  Fly   211 SADTPEELGL-LEGRIQLDMKVIKIELACPRK---VILR--CQDGDY------------------ 251 
  Fly   252 ---------------------------------------FEADHVICTVSLGVL---------QE 268 
  Fly   269 QHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEK---QPLPD--GWVG--------FFCFWLEE 320 
  Fly   321 DLIELRKTEYFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRK-FLTFE 384 
  Fly   385 IPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWD-LESPVL-----GEDGHLGLLFAGEAS 443 
  Fly   444 SRNHFSTVHGAVEAGYREADRLIDHY 469 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5653 | NP_648269.1 | NAD_binding_8 | 12..78 | CDD:290186 | 26/65 (40%) | 
| Amino_oxidase | 17..466 | CDD:279874 | 139/598 (23%) | ||
| Su(var)3-3 | NP_649194.1 | SWIRM | 165..250 | CDD:282311 | |
| NAD_binding_8 | 269..327 | CDD:290186 | 25/58 (43%) | ||
| Amino_oxidase | 274..824 | CDD:279874 | 138/597 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45452797 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm46708 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR10742 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.940 | |||||