DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and smox

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001315115.1 Gene:smox ZFINID:ZDB-GENE-031201-3 Length:539 Species:Danio rerio

Alignment Length:574 Identity:171/575 (30%)
Similarity:253/575 (44%) Gaps:143/575 (25%)


  Fly     1 MEKCRASS-----------------RIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRIN 48
            |:.|..||                 ||::||||::|:||...||:|.|.||.:|||.||||||:.
Zfish     1 MQSCEISSDSTDDPLSSALHGHRQPRIVVIGAGLAGLAATKTLLENGFTNVTVLEASDRIGGRVQ 65

  Fly    49 TVYFGDNVIDLGAQWCHGKQQNCVYDMVKDMGILHETGDYYSPIKRV------------RSNKEV 101
            ::..|...::|||.|.||...|.||.:.:|.|:|..|.:....:.|:            .:|.:.
Zfish    66 SIQHGKTTLELGATWIHGANGNPVYHLAEDNGLLEHTTEEERSVGRISLYAKNGVAHYQTNNGKR 130

  Fly   102 VPHELACRIHDIAVKSMPSGPHPVVGSFGTHLTQTFWR-------KIESELPQVNRDVA------ 153
            :|.:|.....|:..:..             .|||.|::       :.::.:....|||.      
Zfish   131 IPKDLVEEFSDLYNEVY-------------ELTQEFFQNGKPVGAESQNSVGIFTRDVVRKKIML 182

  Fly   154 ----SEA--------LNTFAKHESSIIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRL 206
                ||:        |..:.|.||....:.|:.|||:.|..|:.|..|..  |....|   |:::
Zfish   183 DPYDSESIRKLKLSMLQQYLKVESCESSSPNMDEVSLSEFGEWTEIPGAH--HVIPTG---FIKV 242

  Fly   207 LMKVSADTPEELGLLEGRIQLDMKVIKIELAC---------------------PRKVILRCQDGD 250
            :..::.|.|..:      :.|...|.::...|                     |..|.:.|:||:
Zfish   243 VEILAQDIPSCV------LHLSKPVRRVHWNCSSQDAEEFGDQVDHNQDQRPSPSPVCVECEDGE 301

  Fly   251 YFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFC 315
            ...|||||.|.|||||::.|:.||.|.||..|..||:.|.:.|.:|::||:.:.           
Zfish   302 RLLADHVILTASLGVLKKAHKTLFSPGLPQDKAQAIQKLGISTTDKIFLEFAEP----------- 355

  Fly   316 FW---------LEEDLIELRKTEY---FWVEGITGVHMITCQPR---MLMAWVNGPHGRHMETLS 365
            ||         :.||..:|....|   .|...|....::....|   ||..|:.|.....||...
Zfish   356 FWSPECNSIQFVWEDEAQLESQAYPEELWYRKICSFDVLYPPERYGHMLSGWICGEEALRMERCD 420

  Fly   366 DEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLESPVLG 429
            ||.|.|....|.|:|. ...||.|:|.:||||.|||..|||:|:..|.:..|     |:|.  |.
Zfish   421 DETVAEICTELLRQFTGNQNIPKPRRILRSSWGSNPYIRGSYSFTRVGSSGR-----DVEK--LA 478

  Fly   430 ED---------GHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLIDHYT-SCS 473
            |.         ..|.:||||||:.|.::||.|||:.:|.|||:||::.|. ||:
Zfish   479 EPLPYIKNTKAPPLQVLFAGEATHRKYYSTTHGALLSGQREANRLMELYQYSCA 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 32/66 (48%)
Amino_oxidase 17..466 CDD:279874 158/532 (30%)
smoxNP_001315115.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117594990
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.