DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and Smox

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006235125.1 Gene:Smox RGDID:1306049 Length:585 Species:Rattus norvegicus

Alignment Length:590 Identity:167/591 (28%)
Similarity:243/591 (41%) Gaps:159/591 (27%)


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ 69
            |...|:::||||::|:|||..||:..|.:|.:|||...||||:.:|..|....:|||.|.||...
  Rat    22 RGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHG 86

  Fly    70 NCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVVGSFGT--- 131
            |.:|.:.:..|:|.||.|....:.|:....:   :.:||.:.:...:.    |..||..|..   
  Rat    87 NPIYQLAEANGLLEETTDGERSVGRISLYSK---NGVACYLTNRGRRI----PKDVVEEFSDLYN 144

  Fly   132 ---HLTQTFWR-------------------KIESEL------PQVNRDVASEALNTFAKHESSII 168
               :|||.|:|                   |:.:.:      .:..:.:....:..:.|.||...
  Rat   145 EVYNLTQEFFRNGKPVNAESQNSVGVFTREKVRNRIRDDPDDTEATKRLKLAMIQQYLKVESCES 209

  Fly   169 GADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIK 233
            .:.::.|||:....|:.|..|..  |....|:.|.:.||.|         |:....|||...|..
  Rat   210 SSHSIDEVSLSAFGEWTEIPGAH--HIIPSGFMRVVELLAK---------GIPPHVIQLGKPVRC 263

  Fly   234 IE----LACPR-------------------------------------KVILRCQDGDYFEADHV 257
            |.    .|.||                                     .|::.|:|.:...||||
  Rat   264 IHWDQASARPRGPEIEPRGEGDHNHDAGEGGQSGENPQQGRWDEDEQWPVVVECEDCEVIPADHV 328

  Fly   258 ICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFW----- 317
            |.|||||||:.|:...|.|.||..||.||..|.:||.:|::||:|:.           ||     
  Rat   329 IVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRLGIGTTDKIFLEFEEP-----------FWGPECN 382

  Fly   318 ----LEEDLIELRKTEY---FWVEGITGVHMITCQPR---MLMAWVNGPHGRHMETLSDEKVLEG 372
                :.||..|.....|   .|...|.|..::....|   :|..|:.|.....||...||.|.|.
  Rat   383 SLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERYGHVLSGWICGEEALVMERCDDEAVAEI 447

  Fly   373 LYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDLE------------ 424
            ...:.|:|. ...||.|:|.:||:|.|||.||||:||..|     .:...|:|            
  Rat   448 CTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQV-----GSSGADVEKLAKPLPYTESS 507

  Fly   425 -----SPVLGEDGHL--------------------GLLFAGEASSRNHFSTVHGAVEAGYREADR 464
                 |....:.|||                    .:||:|||:.|.::||.|||:.:|.|||.|
  Rat   508 KTAHGSSTKQQPGHLLSSKCPEQSLDPSRGSIKPMQVLFSGEATHRKYYSTTHGALLSGQREAAR 572

  Fly   465 LIDHY 469
            ||:.|
  Rat   573 LIEMY 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 29/66 (44%)
Amino_oxidase 17..466 CDD:279874 159/574 (28%)
SmoxXP_006235125.1 NAD_binding_8 <45..88 CDD:290186 18/43 (42%)
PLN02568 50..578 CDD:215308 154/563 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117597281
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.