DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and Paox

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006230586.3 Gene:Paox RGDID:1561125 Length:564 Species:Rattus norvegicus

Alignment Length:530 Identity:161/531 (30%)
Similarity:241/531 (45%) Gaps:109/531 (21%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNN-FQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ-NC 71
            |::::|.|::|:.|..||..:. ..::::|||....||||.:......|::|||.|.||..| |.
  Rat    68 RVLVVGGGIAGLGAVQRLCHHRAAPHLRVLEATACAGGRIRSERCFGGVVELGAHWIHGPSQGNP 132

  Fly    72 VYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMPSGPHPVVGSFGTHLTQT 136
            |:.:..:.|:|.|        |.:....::|  |....:...:|....||. .|.....|.:...
  Rat   133 VFQLAAEFGLLGE--------KELSEENQLV--ETGGHVALPSVSCTSSGT-SVSLELVTEMGSL 186

  Fly   137 FWRKI--------ESELP----------QVNRDVAS------------EALNTFAKHESSIIGAD 171
            |:..|        |||.|          ::::.||:            ..||||...|..:.|..
  Rat   187 FYGLIDRTREFLNESETPMASVGEFLKKEISQQVANWTEDENTKRLKLAVLNTFFNIECCVSGTH 251

  Fly   172 NLFEVSVREHIEYHECDG-DKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIKI- 234
            ::..|::....||....| |..|..|.:|      |...:.|..|:|:.:.:       |.:|. 
  Rat   252 SMDLVALAPFGEYTVLPGLDCTLSGGYQG------LTNCILASLPKEVMVFD-------KPVKTI 303

  Fly   235 -------ELACPRK---VILRCQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSL 289
                   |.|.|.:   |::.|:||....|.|||.||.||.|:|..:..|.|||||.|..|||.|
  Rat   304 HWNGSFQEAAFPGETFPVLVECEDGARLPAHHVIVTVPLGFLKEHQDTFFEPPLPAKKAEAIRKL 368

  Fly   290 TLGTVNKLYLEYEKQPLPDGWVGFFCFW----------------LEEDLIELRKTEYFWVEGITG 338
            ..||.||::||:|:.           ||                |::..:.|:.|   |.:.:.|
  Rat   369 GFGTNNKIFLEFEEP-----------FWEPDCQFIQVVWEDTSPLQDSPLSLQDT---WFKKLIG 419

  Fly   339 VHMITC--QPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNP 400
            ..::..  ...:|.|::.|.....|||||||:||..|..:.|:.. ..::|..|..:||.|.|.|
  Rat   420 FLVLPSFESSHVLCAFIAGLQSEFMETLSDEEVLLSLTQVLRRVTGNPQLPAAKSVLRSRWHSAP 484

  Fly   401 NFRGSWSYRGVMADERNTG-PWDLESPVLGEDG---HLGLLFAGEASSRNHFSTVHGAVEAGYRE 461
            ..|||:||..|    .:|| ..||.:..|..||   .|.:||||||:.|..:||.|||:.:|:||
  Rat   485 YTRGSYSYVAV----GSTGDDLDLMAQPLPADGTGTQLQVLFAGEATHRTFYSTTHGALLSGWRE 545

  Fly   462 ADRLIDHYTS 471
            |||||..:.|
  Rat   546 ADRLIGLWDS 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 23/68 (34%)
Amino_oxidase 17..466 CDD:279874 156/516 (30%)
PaoxXP_006230586.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117564173
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.