DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and lsd1

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_595398.1 Gene:lsd1 PomBaseID:SPBC146.09c Length:1000 Species:Schizosaccharomyces pombe

Alignment Length:563 Identity:109/564 (19%)
Similarity:187/564 (33%) Gaps:171/564 (30%)


  Fly     1 MEKCRASSRIIIIGAGVSGIAAATRLLQNNF--------------QNVQILEAEDRIGGRINT-- 49
            :::..:...:.|||||::||:.| |.|.|.|              ..:.|.||.:|:||.|.|  
pombe   251 LDESLSQKTVAIIGAGMAGISCA-RQLTNLFAQYEQDFLSRGEKPPRIVIYEASERLGGHIYTHM 314

  Fly    50 VYFGDNVIDLGAQWCH--GKQQNCVYDMVKDMGILHETGDYYSPIKRVRS-----------NKEV 101
            |...||.:...:....  .....|:.:::.|..|...|.| ..|:..:.|           |:|.
pombe   315 VPLSDNEVSEKSSLATTVNATNECMVNLLTDSLIGMPTLD-SDPLYIISSQQLSLDAVHTRNREF 378

  Fly   102 VPHEL------------ACRIHDIAV---------KSMPSGPHPVVGSFGTHLTQTFWRKIESEL 145
            :.|::            ..|:.|..:         :.:.|...|....|...|.|..|.......
pombe   379 ILHDIENGRIDTEHVQRIFRLFDALLFYFNASASKQPLHSLITPPEQEFIQKLDQIGWYISIEAF 443

  Fly   146 PQVNRDVASEALNTFAKHESSIIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKV 210
            |...:|..||.|...|...:|::            |:...:.   |:..|    ::.:|...:.|
pombe   444 PLQIKDTLSEFLGNSANTLTSLL------------HLTVLDL---KIFEW----FKEYLSQSLSV 489

  Fly   211 S------------------------------------ADTPEELGLLEGRIQLDMKVIKIELACP 239
            |                                    |.||..|.:|..:.   :..:|:|   .
pombe   490 SLENVYPGSIPNLNLLLGENVASYSFKHGMADMLNSLASTPSPLPILFDQC---VHTVKLE---D 548

  Fly   240 RKVILRCQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQ 304
            ..|.|...:......|.|:..:.:..| ..|...|.|||...|:.||.......|.|:.|.::.|
pombe   549 NTVNLSFVNETTVSVDKVVICIPMDKL-NTHLITFEPPLEEKKLKAIDRCHFTNVKKVILIFKTQ 612

  Fly   305 ----------PLPDGWVGFFCF-----WLEEDLIELRKTEYFWVEGITGVHMITCQPRMLMAWVN 354
                      .||......|.|     :.|...:.:    :..||||                  
pombe   613 FWEPNISIFGSLPQDSGRNFIFNDCTRFYEHPTLSV----FVKVEGI------------------ 655

  Fly   355 GPHGRHMETLSDEKVLEGLYWLFRKFL--TFEIPPPKRFVRSSWFSNPNFRGSWSYR--GVMADE 415
                   :.:.|:.::.|:....:|..  ..|...|.|.:.|:| .|.::....||:  .:..:|
pombe   656 -------DFMKDDDIVNGIVSQLKKVYKPKSEAINPIRTIISNW-ENNSYTNHSSYQISNLFLEE 712

  Fly   416 RNTGPWDLESPVLGEDGHLGLLFAGEASSRNHFSTVHGAVEAG 458
                    :..:|.|.....:.||.||.|:.:..::.||.::|
pombe   713 --------DYAILSEPIDNTVFFASEAISQKNSGSIRGAFDSG 747

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 24/84 (29%)
Amino_oxidase 17..466 CDD:279874 104/548 (19%)
lsd1NP_595398.1 SWIRM 157..240 CDD:282311
NAD_binding_8 262..>316 CDD:290186 21/55 (38%)
Amino_oxidase 267..755 CDD:279874 104/548 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.