DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and Smox

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001171304.1 Gene:Smox MGIID:2445356 Length:585 Species:Mus musculus

Alignment Length:594 Identity:165/595 (28%)
Similarity:240/595 (40%) Gaps:167/595 (28%)


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ 69
            |...|:::||||::|:|||..||:..|.:|.:|||...||||:.:|..||...:|||.|.||...
Mouse    22 RGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHIGGRVQSVRLGDTTFELGATWIHGSHG 86

  Fly    70 NCVYDMVKDMGILHETGDYYSPIKRVR--SNKEVVPH--ELACRIHDIAVKSMPSGPHPVVGSFG 130
            |.:|.:.:..|:|.||.|....:.|:.  |...|..:  ...|||           |..||..|.
Mouse    87 NPIYQLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNRGCRI-----------PKDVVEEFS 140

  Fly   131 T------HLTQTFWR-------------------KIESEL------PQVNRDVASEALNTFAKHE 164
            .      ::||.|:|                   |:.:.:      .:..:.:....:..:.|.|
Mouse   141 DLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRIRDDPDDTEATKRLKLAMIQQYLKVE 205

  Fly   165 SSIIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMK-------------------- 209
            |....:.::.|||:....|:.|..|..  |....|:.|.:.||.:                    
Mouse   206 SCESSSHSIDEVSLSAFGEWTEIPGAH--HIIPSGFMRVVELLAEGIPPHVIQLGKPVRCIHWDQ 268

  Fly   210 --------------------------VSADTPEELGLLEGRIQLDMKVIKIELACPRKVILRCQD 248
                                      .|.:.|:     :||...|.         |..|::.|:|
Mouse   269 ASAHPRGPEIEPRGEGDHNHDTGEGGQSGENPQ-----QGRWDEDE---------PWPVVVECED 319

  Fly   249 GDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGF 313
            .:...|||||.|||||||:.|:...|.|.||..||.||..|.:||.:|::||:|:.         
Mouse   320 CEVIPADHVIVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRLGIGTTDKIFLEFEEP--------- 375

  Fly   314 FCFW---------LEEDLIELRKTEY---FWVEGITGVHMITCQPR---MLMAWVNGPHGRHMET 363
              ||         :.||..|.....|   .|...|.|..::....|   :|..|:.|.....||.
Mouse   376 --FWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERYGHVLSGWICGEEALVMER 438

  Fly   364 LSDEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRGSWSYRGV---------------- 411
            ..||.|.|....:.|:|. ...||.|:|.:||:|.|||.||||:||..|                
Mouse   439 CDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSSGADVEKLAKPLPY 503

  Fly   412 ---------MADERNTG-------PWDLESPVLGEDGHLGLLFAGEASSRNHFSTVHGAVEAGYR 460
                     .:.|:..|       |.....|..|....:.:||:|||:.|.::||.|||:.:|.|
Mouse   504 TESSKTAHRSSTEQQPGHLLPSKCPEQSLDPSRGSIKPMQVLFSGEATHRKYYSTTHGALLSGQR 568

  Fly   461 EADRLIDHY 469
            ||.|||:.|
Mouse   569 EAARLIEMY 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 30/66 (45%)
Amino_oxidase 17..466 CDD:279874 157/578 (27%)
SmoxNP_001171304.1 NAD_binding_8 <45..88 CDD:290186 19/43 (44%)
PLN02568 50..578 CDD:215308 152/567 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117597010
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.