DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and Paox

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_722478.2 Gene:Paox MGIID:1916983 Length:504 Species:Mus musculus

Alignment Length:527 Identity:169/528 (32%)
Similarity:248/528 (47%) Gaps:102/528 (19%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNN-FQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHG-KQQNC 71
            |::::|:|::|:.||.:|..:. ..::::|||....||||.:......|::|||.|.|| .|.|.
Mouse     7 RVLVVGSGIAGLGAAQKLCSHRAAPHLRVLEATASAGGRIRSERCFGGVVELGAHWIHGPSQDNP 71

  Fly    72 VYDMVKDMGILHETGDYYSPIKRVRSNKEVVP---HELACRIHDIAVKSM--PSGPHPVVGSFGT 131
            |:.:..:.|:|.|        |.:....::|.   |        :|:.||  .|....|.....|
Mouse    72 VFQLAAEFGLLGE--------KELSEENQLVDTGGH--------VALPSMIWSSSGTSVSLELMT 120

  Fly   132 HLTQTFWRKI--------ESELP----------QVNRDVAS-------------EALNTFAKHES 165
            .:.:.|:..|        |||.|          ::::.|||             ..||||...|.
Mouse   121 EMARLFYGLIERTREFLNESETPMASVGEFLKKEISQQVASWTEDDEDTRKRKLAILNTFFNIEC 185

  Fly   166 SIIGADNLFEVSVREHIEYHECDG-DKLLHWGTKGYR-RFLRLLMK--VSADTPEELGLLEGRIQ 226
            .:.|..::..|::....||....| |.:|..|.:|.. |.|..|.|  |:.|.|.:.....|..|
Mouse   186 CVSGTHSMDLVALAPFGEYTVLPGLDCILAGGYQGLTDRILASLPKDTVAFDKPVKTIHWNGSFQ 250

  Fly   227 LDMKVIKIELACPRK---VILRCQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRS 288
                    |.|.|.:   |::.|:||....|.|||.||.||.|:|..:..|.|||||.|..||:.
Mouse   251 --------EAAFPGETFPVLVECEDGARLPAHHVIVTVPLGFLKEHQDTFFEPPLPAKKAEAIKK 307

  Fly   289 LTLGTVNKLYLEYEKQPL--PDGWVGFFCFWLE---EDLIELRKT----EYFWVEGITGVHMITC 344
            |..||.||::||:| :|.  ||      |.:::   ||...|:.|    :..|.:.:.|   ...
Mouse   308 LGFGTNNKIFLEFE-EPFWEPD------CQFIQVVWEDTSPLQDTALSLQDTWFKKLIG---FLV 362

  Fly   345 QP-----RMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFR 403
            ||     .:|..::.|.....|||||||:||..|..:.|:.. ..::|..|...||.|.|.|..|
Mouse   363 QPSFESSHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPQLPAAKSVRRSQWHSAPYTR 427

  Fly   404 GSWSYRGVMADERNTG-PWDLESPVLGEDG---HLGLLFAGEASSRNHFSTVHGAVEAGYREADR 464
            ||:||..|    .:|| ..||.:..|.|||   .|.:||||||:.|..:||.|||:.:|:|||||
Mouse   428 GSYSYVAV----GSTGDDLDLMAQPLPEDGTGTQLQVLFAGEATHRTFYSTTHGALLSGWREADR 488

  Fly   465 LIDHYTS 471
            |:..:.|
Mouse   489 LVSLWDS 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 23/68 (34%)
Amino_oxidase 17..466 CDD:279874 165/513 (32%)
PaoxNP_722478.2 PLN02568 6..490 CDD:215308 168/521 (32%)
NAD_binding_8 10..79 CDD:290186 23/69 (33%)
Microbody targeting signal. {ECO:0000255} 502..504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117563887
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.