DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and PAOX

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_690875.1 Gene:PAOX HGNCID:20837 Length:511 Species:Homo sapiens

Alignment Length:519 Identity:160/520 (31%)
Similarity:239/520 (46%) Gaps:97/520 (19%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNN-FQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ-NC 71
            |::::|.|::|:.||.||..:: |.::::|||..|.||||.:......|:::||.|.||..: |.
Human    15 RVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNP 79

  Fly    72 VYDMVKDMGILH-----------ETGDYYS--PIKRVRSNKEV---VPHELACRIHDIAVKS--- 117
            |:.:..:.|:|.           |||.:..  .:....|...|   :..|:|...:.:..::   
Human    80 VFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTREF 144

  Fly   118 --MPSGPHPVVGSF-----GTHLTQTFWRKIESELPQVNRDVASEALNTFAKHESSIIGADNLFE 175
              ....|.|.||.:     |.|:..  |.:.|.     .|.:....||:|...|..:.|..::..
Human   145 LHAAETPVPSVGEYLKKEIGQHVAG--WTEDEE-----TRKLKLAVLNSFFNLECCVSGTHSMDL 202

  Fly   176 VSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIKI------ 234
            |::....||....|  |....:|||:.....:|   |..||:..:.|       |.:|.      
Human   203 VALAPFGEYTVLPG--LDCTFSKGYQGLTNCMM---AALPEDTVVFE-------KPVKTIHWNGS 255

  Fly   235 --ELACPRK---VILRCQDGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTV 294
              |.|.|.:   |.:.|:|||.|.|.|||.||.||.|:|..:..|.|||||.|..|||.:..||.
Human   256 FQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTN 320

  Fly   295 NKLYLEYEKQPLPDGWVGFFCFW----------------LEEDLIELRKTEYFWVEGITGVHMIT 343
            ||::||:|:.           ||                ||:...||:..   |...:.|..::.
Human   321 NKIFLEFEEP-----------FWEPDCQLIQLVWEDTSPLEDAAPELQDA---WFRKLIGFVVLP 371

  Fly   344 --CQPRMLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRGS 405
              ....:|..::.|.....|||||||:||..|..:.|:.. ...:|.||..:||.|.|.|..|||
Human   372 AFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGS 436

  Fly   406 WSYRGVMADERNTGPWDLESPVLGEDG---HLGLLFAGEASSRNHFSTVHGAVEAGYREADRLI 466
            :||   :|.....|..||.:..|..||   .|.:||||||:.|..:||.|||:.:|:||||||:
Human   437 YSY---VAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYSTTHGALLSGWREADRLL 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 24/68 (35%)
Amino_oxidase 17..466 CDD:279874 157/510 (31%)
PAOXNP_690875.1 PLN02568 14..497 CDD:215308 160/518 (31%)
NAD_binding_8 <43..87 CDD:290186 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117564067
eggNOG 1 0.900 E1_KOG0685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.