DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5653 and amx-3

Sequence 1:NP_648269.1 Gene:CG5653 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001355373.1 Gene:amx-3 WormBaseID:WBGene00000139 Length:450 Species:Caenorhabditis elegans

Alignment Length:502 Identity:121/503 (24%)
Similarity:212/503 (42%) Gaps:100/503 (20%)


  Fly     9 RIIIIGAGVSGIAAATRLLQNNFQNV----QILEAEDRIGGRINTVYFGDNVIDLGAQWCHGKQQ 69
            ::.|||||::|:.:|.     :|:.|    .|.|..:|||||:....:.|..:..||::.:| ..
 Worm     3 KVCIIGAGLAGLRSAI-----HFEQVGIDYTIFEGSNRIGGRVYPFEYQDGYLHFGAEYVNG-VD 61

  Fly    70 NCVYDMVKDMGILHETG---------DYYSPIKRVRSNKEVVPHELACRIHD------IAV--KS 117
            |.||::|:...:..:|.         |..:.|..|  |..:||.::..:.:|      :|:  ||
 Worm    62 NEVYNLVEKYDLFDKTKPRTDDLWMLDQDNSITLV--NGHLVPKKILDKFNDYIRYLNVALYEKS 124

  Fly   118 MPSGPHPVVGSFGTHLTQTFWRKIESELPQVNRDVASEALNTFAKHESSIIGADNLFEVSVREHI 182
            :......|.........: |.|.:.....::...:.:...|.|....||.:|..:|..:|:.:  
 Worm   125 IKINQLSVENEINNQFIE-FLRDVPENDHEIYESLINVYKNYFQTEWSSPVGELSLSNLSIWD-- 186

  Fly   183 EYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQLDMKVIKIELACPRKVILRCQ 247
                 ||.:.........:.|..:|....:..|      .|.|:|:.:||.::.  ...:::..:
 Worm   187 -----DGTEEEDSAVLNKQGFYEILKDFRSKIP------AGNIRLNCEVINVKE--EENIMVTLK 238

  Fly   248 DGDYFEADHVICTVSLGVLQEQHEKLFVPPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVG 312
            :|:....|..|.|.|||.|::.|:.||.|.|.:.|.:||..:..|...|::|||.     |.|  
 Worm   239 NGEVLHFDACIVTCSLGYLKKHHKTLFTPQLTSVKQDAINRMGFGNNLKVFLEYS-----DSW-- 296

  Fly   313 FFCFW------------LEEDLIELRKTEYFWVEGITGVHMITCQPRMLMAWV--NGPHGRHMET 363
                |            ..||.:..:.:.  |.|.|            |:.|:  :||.....:|
 Worm   297 ----WNSLNTILILTHGENEDFMVFQPSS--WAENI------------LLCWIAGSGPKKICDKT 343

  Fly   364 LSDEKVL--EGLYWLFRKFLTFEIPPPKRFVRSSWFSNPNFRGSWSY--RGVMADERNTGPWD-- 422
            ..:.|:|  ..|:...:.:|  ::....:..|.:|.::....||:||  .|.:..|      |  
 Worm   344 DFELKILLDTHLHDQLKNYL--DVKASVKIYRKNWINDEFTLGSYSYLTPGQIVGE------DIC 400

  Fly   423 -LESPVLGEDGHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLIDH 468
             |..||| :|.:..:.||||.:....:.|..|||.:|.|||.|:.:|
 Worm   401 ILAQPVL-KDNNPVICFAGEHTDSTMYQTTVGAVRSGLREASRISEH 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 24/70 (34%)
Amino_oxidase 17..466 CDD:279874 115/491 (23%)
amx-3NP_001355373.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375579at33208
OrthoFinder 1 1.000 FOG0000545
OrthoInspector 1 1.000 T98007
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.