DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GNBP3 and XTH21

Sequence 1:NP_523986.2 Gene:GNBP3 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_179470.1 Gene:XTH21 AraportID:AT2G18800 Length:305 Species:Arabidopsis thaliana

Alignment Length:174 Identity:39/175 (22%)
Similarity:66/175 (38%) Gaps:55/175 (31%)


  Fly   236 KGSGESLDL--GEKCTGQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQ 298
            |...:.:|:  |:   |:.|   .:.||..||.||.....:.|.|| ..:.||:|:::.|:    
plant    26 KDFNQDIDITWGD---GRGN---ILNNGTLLNLGLDQSSGSGFQSK-AEYLYGKVDMQIKL---- 79

  Fly   299 WVTPQIWLQPRRPIYGVDDYRSGQLRIAYTRPNG-----------GNLDLYGAAVLFADEPLRSV 352
                            |....:|.:...|.:..|           ||:         :.:|....
plant    80 ----------------VPGNSAGTVTTFYLKSQGLTWDEIDFEFLGNV---------SGDPYIVH 119

  Fly   353 KNCLKPGTGNNSED---WSD---SFHNYTLEWTPRELRWLVDGK 390
            .|....|.|:..:.   |.|   :||||::.|.|..:.:.:|||
plant   120 TNVYTQGKGDREQQFYLWFDPTAAFHNYSILWNPSHIVFYIDGK 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 39/175 (22%)
XTH21NP_179470.1 GH16_XET 27..296 CDD:185685 38/174 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1209387at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.