DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GNBP3 and GNBP2

Sequence 1:NP_523986.2 Gene:GNBP3 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_524141.1 Gene:GNBP2 FlyBaseID:FBgn0040322 Length:461 Species:Drosophila melanogaster

Alignment Length:531 Identity:142/532 (27%)
Similarity:225/532 (42%) Gaps:132/532 (25%)


  Fly    13 CLQLLFLLLGVQGYEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARD-I 76
            ||.||.....:.|::||....::...:|||||||||.||....:..::::....|      .| |
  Fly     8 CLLLLISNNKIFGFKVPSINFEMLKDEGFEVSIPDEPGIQRVFYMFQIDDTCPAL------MDYI 66

  Fly    77 VKAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVNGYSGNNASPHPPVVPVSTT 141
            .:|.||.|..:.:: :|:..|.|.....|.:|...:.:.:...::|             ..:.||
  Fly    67 TEAVNGSWVSKQKM-SLQNNDKLQISMLVQFNEEIFEKSETRVIIN-------------TRLLTT 117

  Fly   142 ------------------PWTPPADPDIDIRLGCTTPKTEVNGAPTRCAGQLVFVDEFNAAKLDP 188
                              .:..||..    ...|...:|.|:.....|.|:|:|.|.|:.|:|:.
  Fly   118 KDSSSRGITFLTGEGECQAYLAPAQQ----AKRCKAAQTIVSNGRHTCQGELIFEDNFSEAQLNK 178

  Fly   189 NKWKAERRFSGQPDYEFNVYVDDAPETLCLANG--HVV--LSTNTMKKQFKKGSGESLDLGEKCT 249
            ..||.:.|.......|..|..|||.....:..|  |:|  ::|......||        ||::||
  Fly   179 TTWKHDIRQRMYHVEEELVAFDDAARNCFVKEGELHIVPTIATEVTDGSFK--------LGDRCT 235

  Fly   250 G-QANTHDCVRNGRTLNDGL-----PPMVTAQFSSKD-FSFKYGRVEVRAKMPRAQWVTPQIWLQ 307
            . ::...:|     .:..|:     ||:.:||..::: ||||:|::.||||:|:..|:.|.:.||
  Fly   236 AVESPEQEC-----NIAHGIFYSIKPPVFSAQIHTRNSFSFKFGKIVVRAKLPKGDWLFPYLMLQ 295

  Fly   308 PRRPIYGVDDYR----SGQLRIAYTRPN-----------GGNLDLYGAAVLFADEPLRSVKNCLK 357
            |      |..|.    :.||||||.|.|           .|| .|||..|::..   .:....||
  Fly   296 P------VSTYAETHYAKQLRIAYARGNANLRTKQGDDISGN-HLYGGGVVWHH---GNAVQFLK 350

  Fly   358 PGTGNNSEDWSDSFHNYTLEWTPRELRWLVDGKEWCVQGSAKGSFSETTAAGKSLPQAQKLEEGT 422
            ....|:  .:.|.|||||:.|...::..:||.:   |.|                      |...
  Fly   351 DKISNS--HYGDDFHNYTMIWQRDKITLMVDDE---VYG----------------------ELYD 388

  Fly   423 GLAPFDQEFYLTFGLSVGGFNEYQ-----HEIKPWNERAPQAQKAFWKEVKKIRDHWLD----EG 478
            ||..|:::.::.||::||||..:.     .::||:..|.|:|..:||:.    ||.|..    ..
  Fly   389 GLPFFNEKCFIIFGVTVGGFLNFDDSLLAKDVKPYKNREPRAALSFWQH----RDAWAPTWGRHS 449

  Fly   479 HMKIDYVKVYS 489
            .|.||||:||:
  Fly   450 AMVIDYVRVYA 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510 26/106 (25%)
GH16_beta_GRP 175..489 CDD:185688 102/349 (29%)
GNBP2NP_524141.1 CBM39 22..120 CDD:292510 28/118 (24%)
GH16_beta_GRP 165..460 CDD:185688 102/349 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124150131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10963
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.