DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GNBP3 and GNBP-like3

Sequence 1:NP_523986.2 Gene:GNBP3 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_611483.1 Gene:GNBP-like3 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster

Alignment Length:130 Identity:65/131 (50%)
Similarity:83/131 (63%) Gaps:11/131 (8%)


  Fly    17 LFLLLGVQG----YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIV 77
            |||:....|    |:||||.:.|..|||||||||||.||:|||||||:||||:.|...|||.|:|
  Fly    11 LFLVAISVGSSLSYDVPKATVKVNSPKGFEVSIPDEPGISLFAFHGKVNEEMDDLSDQTWAADVV 75

  Fly    78 KAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVN-------GYSGNNASPHPPV 135
            .::|||||:|:|...|:|||.|||||...|:|:.|...:..:||.       ..:|:|....|.|
  Fly    76 SSRNGRWTYRNRNHQLRPGDVLYYWTTARYHGVDYHNYNQRYVVGQGDSQRIDVNGSNGGRQPIV 140

  Fly   136  135
              Fly   141  140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510 58/112 (52%)
GH16_beta_GRP 175..489 CDD:185688
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 56/95 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133415130
eggNOG 1 0.900 E1_COG2273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.