DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mcm7 and MCM8

Sequence 1:NP_523984.1 Gene:Mcm7 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001319512.1 Gene:MCM8 AraportID:AT3G09660 Length:801 Species:Arabidopsis thaliana

Alignment Length:613 Identity:190/614 (31%)
Similarity:303/614 (49%) Gaps:108/614 (18%)


  Fly   122 ERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDR 186
            |.|.|.:.:.....:...|   |.:.|::.::|.:|||||||.|.|.:.:.|||::....:.|.:
plant   121 ETNEFENVMKINVRLHNYP---ESSISLKNLRAAYIGKLVTVHGTVVKVSTVKPLVTQMAFDCGK 182

  Fly   187 CGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGS-KFVKFQEVKMQE------HSDQV 244
            |.:...:......|:|...|.|..|:     .:.:...|.| :.:.||::::||      |.:  
plant   183 CKTGITREFTDGKFSPPLKCDSHGCK-----SKTFTPIRSSAQTIDFQKIRVQELQKPEDHEE-- 240

  Fly   245 PVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQM---IQGLLSETFLQAHRIICI 306
              |.:||::......::..:..|||.:.|:|:.      |....   |.|..|:|..|....:.|
plant   241 --GRVPRTVECELMEDLVDICIPGDVVTVTGII------GVINNYMDIGGGKSKTKNQGFYYLFI 297

  Fly   307 ---------------NKND--------------EISDKDAELTPEELEELAQDDFYERLATSLAP 342
                           |..|              ..|.:|.|...:..||...|.| .|:..|:.|
plant   298 EAVSVKNTKRQSAFENSEDSSSSAQTADVGDLYSFSQRDLEFIVKFKEEYGSDTF-RRILHSVCP 361

  Fly   343 EIYGHLDVKKALLLLLVGGVDKRP---DGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYT 404
            .||||..||..:.|.|.|||.|..   :.:.:||:|::.::||||:.|||||...:.::.|..|.
plant   362 SIYGHEIVKAGITLSLFGGVRKHSMDRNKVPVRGDIHVIIVGDPGLGKSQLLQAAAAISPRGIYV 426

  Fly   405 TGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISI 469
            .|..::..|||.||:||.:|.:...|.||:||||.|:|||||||||..:.: |:.|.||||.:|:
plant   427 CGNATTRAGLTVAVVKDSMTNDYAFEAGAMVLADGGLCCIDEFDKMTTEHQ-ALLEAMEQQCVSV 490

  Fly   470 AKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLA 534
            ||||::.:|:||.|::|||||..|.||..:||.:|:::.|||||||||::::.||||...|.:::
plant   491 AKAGLVASLSARTSVIAAANPVGGHYNRAKTVNENLKMSAALLSRFDLVFILLDKPDELLDKQVS 555

  Fly   535 KHITYVHSHSKQPPTRVK------ALDMN---------------------------------LMR 560
            :||..:||.|.:....:|      |...|                                 |:|
plant   556 EHIMSLHSASGETSPALKKFKPVNAASQNAGYANMHAEGNSLLSRLRLDSEKDDDFSPVPGQLLR 620

  Fly   561 RYINLCKR-KNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDS 624
            :||:..:. .||.:..:..:.|...|::| |:.....|.|..:||.|..::||:.|.||:.|.:.
plant   621 KYISYARNFVNPKMSKDAGEIIQKFYLKL-RDHNTSADSTPITARQLESLVRLAQARARVDLREE 684

  Fly   625 VEKDDVAEALRLLEMSKDSL--NQIHEH 650
            :   .|.:|:.::|:.|:||  ..|.||
plant   685 I---TVQDAMDVVEIMKESLYDKLIDEH 709

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..165 CDD:291233 14/43 (33%)
MCM 145..641 CDD:214631 179/578 (31%)
P-loop_NTPase 376..515 CDD:304359 69/139 (50%)
MCM_bind <556..619 CDD:286782 21/97 (22%)
MCM8NP_001319512.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D266497at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.